Tackling Bet v 1 and associated food allergies with a single hybrid protein. | ImmuneData Discovery Index

Immunological Data Discovery Index

Immunological Data Discovery Index

Title:

Tackling Bet v 1 and associated food allergies with a single hybrid protein.

Dataset

identifier:	3468209
description:	epitope description:NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQV antigen name:Bet v 1 host organism:Homo sapiens mhc allele name:HLA class II
aggregation:	instance of dataset
availability:	available
primaryPublications:	27939703

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1032000
landingPage:	http://www.iedb.org/assay/3468209

Publication

type:	Literature
publicationVenue:	J Allergy Clin Immunol
dates:	2017

Dimension

study type:	t cell assays
subject species:	Betula pendula

Person

fullName:	Heidi Hofer Claudia Asam Michael Hauser Birgit Nagl Josef Laimer Martin Himly Peter Briza Christof Ebner Roland Lang Thomas Hawranek Barbara Bohle Peter Lackner Fá tima Ferreira Michael Wallner

Data Type

method:	3H-thymidine

Study

name:	Tackling Bet v 1 and associated food allergies with a single hybrid protein.
description:	The epitope was deduced. T cell lines responded to overlapping 12-mer peptides to map the epitopic region.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.