Antibody to a synthetic peptide detects a conserved region of retrovirus transmembrane proteins.

ID: 1465980

Description: epitope description:EVVLQNRRGLDLL antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus New Zealand White

Antibody to a synthetic peptide detects a conserved region of retrovirus transmembrane proteins.

ID: 1465981

Description: epitope description:EVVLQNRRGLDLL antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus New Zealand White

Localization and characterization of Sendai virus nonstructural C and C' proteins by antibodies against synthetic peptides.

ID: 1465993

Description: epitope description:MPSFLKKILKLRGRRQEEESRSRMLSDSSM antigen name:Protein C' host organism:Oryctolagus cuniculus antibody name:Rabbit antisera

Localization and characterization of Sendai virus nonstructural C and C' proteins by antibodies against synthetic peptides.

ID: 1465995

Description: epitope description:YVKSLSKCKTDQEVKAVMELVEEDIESLTN antigen name:Phosphoprotein host organism:Oryctolagus cuniculus antibody name:Rabbit antisera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466001

Description: epitope description:FFRSTPEDLERAEK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466020

Description: epitope description:PVKKPVALKVKAKN antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466022

Description: epitope description:YNRNAVPNLRGDLQV antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466040

Description: epitope description:SEKSKCEENTMFQPY antigen name:envelope polyprotein host organism:Equus caballus

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466042

Description: epitope description:SEEKFVTMTDLVPGI antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466044

Description: epitope description:SEEKFVTMTDLVPGI antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466046

Description: epitope description:VTMTDLVPGILEKQR antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466047

Description: epitope description:VTMTDLVPGILEKQR antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Assessment of protective immune responses against hydatid disease in sheep by immunization with synthetic peptide antigens.

ID: 1466050

Description: epitope description:TETPLRKHFNLTPV antigen name:Antigen protein host organism:Ovis aries Merino X Border Leiscester

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466052

Description: epitope description:NEYIEKANITTDDK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466060

Description: epitope description:ERTLPGQKACDDVN antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466063

Description: epitope description:GPYAGPLERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466067

Description: epitope description:PYCYNNDSKNSMAESKEAR antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466075

Description: epitope description:WGSFPGCRPFQNYFSYET antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466076

Description: epitope description:WGSFPGCRPFQNYFSYET antigen name:envelope polyprotein host organism:Equus caballus

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466085

Description: epitope description:PLERQKPLKVRAKL antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466087

Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466088

Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466089

Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466091

Description: epitope description:PMERQKPLKVKAKA antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466093

Description: epitope description:PMERQKPLKVKAKA antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466096

Description: epitope description:PVKKPVALKVKAKN antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466112

Description: epitope description:REITFIYKSSCTDSDH antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466113

Description: epitope description:TDSDHCQEYQCKKVNLNSSDS antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466115

Description: epitope description:SSDSSNSVRVEDVTNTAEYWGFKWLECNQT antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466121

Description: epitope description:KGCNETWARVKRCPIDILYGIHPIRLCVQ antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466124

Description: epitope description:RLCVQPPFFLVQEKGIADTSR antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466126

Description: epitope description:ADTSRIGNCGPTIFLGVLED antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466127

Description: epitope description:LGVLEDNKGVVRGDYTAC antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466131

Description: epitope description:TGIYQVPIFYTCTFTNITSCNSKPII antigen name:envelope polyprotein host organism:Equus caballus

Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

ID: 1466155

Description: epitope description:VYAEINVKALKLSLESNGGA antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

ID: 1466159

Description: epitope description:TPSKYGLGGDILFGWERTRE antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

ID: 1466175

Description: epitope description:ELAWGIASDGGALKHGFKTT antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

ID: 1466176

Description: epitope description:FKIVFPIVAKKDFKYRGEGN antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466192

Description: epitope description:RPKHPIKHQGLPQEVLNENL antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466200

Description: epitope description:LNENLLRFFVAPFPQVFGKE antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466281

Description: epitope description:SESTEDQAMEDIKQMEAESI antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466283

Description: epitope description:SESTEDQAMEDIKQMEAESI antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein (1-20)

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466292

Description: epitope description:VEQKHIQKEDVPSERYLGYL antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466294

Description: epitope description:VEQKHIQKEDVPSERYLGYL antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein (1-20)

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466299

Description: epitope description:YLGYLEQLLRLKKYKVPQLE antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466318

Description: epitope description:IGVNQELAYFYPELFRQFYQ antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466325

Description: epitope description:RQFYQLDAYPSGAWYYVPLG antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466328

Description: epitope description:YVPLGTQYTDAPSFSDIPNP antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466331

Description: epitope description:YVPLGTQYTDAPSFSDIPNP antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein (1-20)

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466336

Description: epitope description:DIPNPIGSENSEKTTMPLW antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Characterization of rubella virus-specific antibody responses by using a new synthetic peptide-based enzyme-linked immunosorbent assay.

ID: 1466405

Description: epitope description:NQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus antibody name:12B2D, 12B3G, 13A4H, 21B9...

Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

ID: 1466514

Description: epitope description:RVFPRGTVENPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(1-2...

Localization of linear B-cell epitopes on infectious bronchitis virus nucleocapsid protein.

ID: 1466517

Description: epitope description:YPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAAASRAP antigen name:Nucleoprotein host organism:Gallus gallus

Localization of linear B-cell epitopes on infectious bronchitis virus nucleocapsid protein.

ID: 1466521

Description: epitope description:DLIARAAKIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPNYRVDQV antigen name:Nucleoprotein host organism:Gallus gallus

Localization of linear B-cell epitopes on infectious bronchitis virus nucleocapsid protein.

ID: 1466523

Description: epitope description:DGRVTAMLNLVPSSHACLFGSRVTPKLQLDGLH antigen name:Nucleoprotein host organism:Gallus gallus

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466539

Description: epitope description:FSKCGFPFSLLVDAPGYDPIWFL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466548

Description: epitope description:QHDVNFTQEVSRLNINLHFSKCG antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466549

Description: epitope description:PIWFLNTEPSQLPPTAPPLLPHS antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466551

Description: epitope description:LALSADQALQPPCPNLVSYSSYH antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

ID: 1466553

Description: epitope description:RVFPRGTVENPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(10-...

Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

ID: 1466554

Description: epitope description:RVFPRGTVENPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(12-...

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466560

Description: epitope description:VKNHKNLLKIAQYAAQNRRGLDL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466565

Description: epitope description:PLENRVLTGWGLNWDLGLSQWAR antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

ID: 1466570

Description: epitope description:RVFPRGTVENPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(1-2...

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466572

Description: epitope description:ITSEPTQPPPTSPPLVHDSDLEHV antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466573

Description: epitope description:PLVHDSDLEHVLTPSTSWTTKILK antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466574

Description: epitope description:LVHDSDLEHVLTPSTSWTTKI antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466588

Description: epitope description:PLVHDSDLEHVLTPSTSWTTKILK antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466589

Description: epitope description:LVHDSDLEHVLTPSTSWTTKI antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466595

Description: epitope description:GLDLLPWEQGGLCKAIQEQCCFLN antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

Elucidation of linear epitopes of pertussis toxin using overlapping synthetic decapeptides: identification of a human B-cell determinant in the S1 sub...

ID: 1469919

Description: epitope description:LAHRRIPPENIR antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus antibody name:Anti-PT serum

Elucidation of linear epitopes of pertussis toxin using overlapping synthetic decapeptides: identification of a human B-cell determinant in the S1 sub...

ID: 1469921

Description: epitope description:DDPPATVYRYD antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus antibody name:Anti-PT serum

Elucidation of linear epitopes of pertussis toxin using overlapping synthetic decapeptides: identification of a human B-cell determinant in the S1 sub...

ID: 1469924

Description: epitope description:CQVGSSNSAF antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus antibody name:Anti-PT serum

Characterization of a Lactococcus lactis strain that secretes a major epitope of bovine beta-lactoglobulin and evaluation of its immunogenicity in mic...

ID: 1469932

Description: epitope description:VYVEELKPTPEGDLEILLQK antigen name:Bos d 5 host organism:Mus musculus BALB/c

Elucidation of linear epitopes of pertussis toxin using overlapping synthetic decapeptides: identification of a human B-cell determinant in the S1 sub...

ID: 1469937

Description: epitope description:AMAAWSERAGEA antigen name:Pertussis toxin subunit 1 host organism:Homo sapiens antibody name:Pertussis-specific human sera

Immunogenicity of synthetic peptides derived from the sequences of a Streptococcus mutans cell surface antigen in nonhuman primates.

ID: 1470371

Description: epitope description:GGVATY antigen name:Other Streptococcus mutans protein host organism:Macaca

Immunogenicity of synthetic peptides derived from the sequences of a Streptococcus mutans cell surface antigen in nonhuman primates.

ID: 1470372

Description: epitope description:GGVATY antigen name:Other Streptococcus mutans protein host organism:Macaca

Identification and localization of a limited number of predominant conformation-independent antibody epitopes of Theiler's murine encephalomyelitus vi...

ID: 1470402

Description: epitope description:QNTEEMENLSDRV antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Mouse anti-TMEV antisera

Two monoclonal antibodies with defined epitopes of P44 major surface proteins neutralize Anaplasma phagocytophilum by distinct mechanisms.

ID: 1468674

Description: epitope description:GDSSNAGT antigen name:p44 outer membrane protein (UniProt:S5PK85) host organism:Equus caballus antibody name:Horse plasma

Two monoclonal antibodies with defined epitopes of P44 major surface proteins neutralize Anaplasma phagocytophilum by distinct mechanisms.

ID: 1468687

Description: epitope description:RESNGETK antigen name:p44 outer membrane protein (UniProt:S5PK85) host organism:Mus musculus C3H/He antibody name:mouse plasma

Two monoclonal antibodies with defined epitopes of P44 major surface proteins neutralize Anaplasma phagocytophilum by distinct mechanisms.

ID: 1468690

Description: epitope description:DGKSVKLE antigen name:p44 outer membrane protein (UniProt:S5PK85) host organism:Mus musculus C3H/He antibody name:mouse plasma

Two monoclonal antibodies with defined epitopes of P44 major surface proteins neutralize Anaplasma phagocytophilum by distinct mechanisms.

ID: 1468695

Description: epitope description:ETKRKDGD antigen name:p44 outer membrane protein (UniProt:S5PK85) host organism:Mus musculus C3H/He antibody name:mouse plasma

Two monoclonal antibodies with defined epitopes of P44 major surface proteins neutralize Anaplasma phagocytophilum by distinct mechanisms.

ID: 1468698

Description: epitope description:FAKYIVGA antigen name:p44 outer membrane protein (UniProt:S5PK85) host organism:Mus musculus C3H/He antibody name:mouse plasma

Use of synthetic peptides to map sequential epitopes recognized by monoclonal antibodies on the bovine leukemia virus external glycoprotein.

ID: 1468706

Description: epitope description:PISLVNLSTASSAPPTRVRR antigen name:gp60 SU host organism:Mus musculus BALB/c antibody name:A

Use of synthetic peptides to map sequential epitopes recognized by monoclonal antibodies on the bovine leukemia virus external glycoprotein.

ID: 1468733

Description: epitope description:FCAKSPRYTLDSVNGYPKIY antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope

Use of synthetic peptides to map sequential epitopes recognized by monoclonal antibodies on the bovine leukemia virus external glycoprotein.

ID: 1468736

Description: epitope description:STVSSAPPTRVRR antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope

Use of synthetic peptides to map sequential epitopes recognized by monoclonal antibodies on the bovine leukemia virus external glycoprotein.

ID: 1468742

Description: epitope description:LLNQTARAFPDCA antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope

Identification and localization of a limited number of predominant conformation-independent antibody epitopes of Theiler's murine encephalomyelitus vi...

ID: 1468960

Description: epitope description:TLFFPWPTPTTTKINADNPVPILELE antigen name:Cardiovirus B protein host organism:Mus musculus BALB/c antibody name:Mouse anti-TMEV anti...

Two epitopes shared by Taenia crassiceps and Taenia solium confer protection against murine T. crassiceps cysticercosis along with a prominent T1 resp...

ID: 1468995

Description: epitope description:GNLLLSCL antigen name:Protective recombinant antigen (UniProt:Q26874) host organism:Mus musculus BALB/c antibody name:mouse serum

Two epitopes shared by Taenia crassiceps and Taenia solium confer protection against murine T. crassiceps cysticercosis along with a prominent T1 resp...

ID: 1468998

Description: epitope description:APMSTPSATSVR antigen name:Protective recombinant antigen (UniProt:Q26874) host organism:Mus musculus BALB/c antibody name:mouse se...

Location of antigenic sites defined by neutralizing monoclonal antibodies on the S1 avian infectious bronchitis virus glycopolypeptide.

ID: 1469095

Description: epitope description:S380 antigen name:Spike glycoprotein host organism:Mus musculus antibody name:mAb 48.1

Location of antigenic sites defined by neutralizing monoclonal antibodies on the S1 avian infectious bronchitis virus glycopolypeptide.

ID: 1469098

Description: epitope description:G286 antigen name:Spike glycoprotein host organism:Mus musculus antibody name:mAb 62.2

Location of antigenic sites defined by neutralizing monoclonal antibodies on the S1 avian infectious bronchitis virus glycopolypeptide.

ID: 1469099

Description: epitope description:Y294 antigen name:Spike glycoprotein host organism:Mus musculus antibody name:mAb 48.2

Location of antigenic sites defined by neutralizing monoclonal antibodies on the S1 avian infectious bronchitis virus glycopolypeptide.

ID: 1469101

Description: epitope description:H131 antigen name:Spike glycoprotein host organism:Mus musculus antibody name:mAb 52.1

Immune response to synthetic peptides of hepatitis delta antigen.

ID: 1469264

Description: epitope description:RGNQGFPWDILFPADPPFSPQSC antigen name:Large delta antigen host organism:Homo sapiens

Immune response to synthetic peptides of hepatitis delta antigen.

ID: 1469265

Description: epitope description:RGNQGFPWDILFPADPPFSPQSC antigen name:Large delta antigen host organism:Homo sapiens

Roles of carbohydrates on Cry j 1, the major allergen of Japanese cedar pollen, in specific T-cell responses.

ID: 1469367

Description: epitope description:KSMKVTVAFNQFGPN antigen name:Cry j 1 host organism:Mus musculus antibody name:K8.238

Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

ID: 1469433

Description: epitope description:VTLGPKGRHVVI antigen name:60 kDa chaperonin host organism:Homo sapiens

Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

ID: 1469478

Description: epitope description:VLAEAIYTEGLR antigen name:60 kDa chaperonin host organism:Oryctolagus cuniculus New Zealand White

Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

ID: 1469480

Description: epitope description:SANNDAEIGNLI antigen name:60 kDa chaperonin host organism:Oryctolagus cuniculus New Zealand White