Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. A monoclonal antibody against a carbohydrate epitope in lipopolysaccharide differentiates Chlamydophila psittaci from Chlamydophila pecorum, Chlamydop...

    ID: 1409758

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:A2...

    Publication: 16282606;

  2. A monoclonal antibody against a carbohydrate epitope in lipopolysaccharide differentiates Chlamydophila psittaci from Chlamydophila pecorum, Chlamydop...

    ID: 1409759

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S25-23

    Publication: 16282606;

  3. A monoclonal antibody against a carbohydrate epitope in lipopolysaccharide differentiates Chlamydophila psittaci from Chlamydophila pecorum, Chlamydop...

    ID: 1409763

    Description: epitope description:alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BA...

    Publication: 16282606;

  4. A synthetic glycoconjugate representing the genus-specific epitope of chlamydial lipopolysaccharide exhibits the same specificity as its natural count...

    ID: 1409777

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:A2...

    Publication: 1372290;

  5. A synthetic glycoconjugate representing the genus-specific epitope of chlamydial lipopolysaccharide exhibits the same specificity as its natural count...

    ID: 1409778

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S5-10

    Publication: 1372290;

  6. A synthetic glycoconjugate representing the genus-specific epitope of chlamydial lipopolysaccharide exhibits the same specificity as its natural count...

    ID: 1409783

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S25-27, S25-2

    Publication: 1372290;

  7. Elimination of immune tolerance to hepatitis virus in an animal model.

    ID: 1409786

    Description: epitope description:TPEEDQDAREAFRRYQEERPPE antigen name:Large envelope protein host organism:Anas

    Publication: 1395838;

  8. Detection of human antibodies using ""convergent"" combinatorial peptide libraries or ""mixotopes"" designed from a nonvariable antigen: application t...

    ID: 1409790

    Description: epitope description:AVDTGSGGGGQPHDTAPRGARKKQ antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 9924994;

  9. Production and characterization of peptide mimotopes of phenolic glycolipid-I of Mycobacterium leprae.

    ID: 1409799

    Description: epitope description:WTLGPYV host organism:Mus musculus BALB/c antibody name:III603.8

    Publication: 15094167;

  10. A synthetic glycoconjugate representing the genus-specific epitope of chlamydial lipopolysaccharide exhibits the same specificity as its natural count...

    ID: 1409817

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:L2I-6

    Publication: 1372290;

  11. Inducing tolerance by intranasal administration of long peptides in naive and primed CBA/J mice.

    ID: 1409856

    Description: epitope description:LIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY antigen name:Api m 1 host organism:Mus musculus CBA/J

    Publication: 10975871;

  12. A common epitope on major allergens from non-biting midges (Chironomidae).

    ID: 1409868

    Description: epitope description:GVTHDQLNNFR antigen name:Chi t 1 host organism:Oryctolagus cuniculus antibody name:anti-Chi t I

    Publication: 2464134;

  13. A common epitope on major allergens from non-biting midges (Chironomidae).

    ID: 1409870

    Description: epitope description:GVTHDQLNNFR antigen name:Chi t 1 host organism:Mus musculus BALB/c antibody name:mAb 5, 6, 7, 15

    Publication: 2464134;

  14. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409872

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C3H/He

    Publication: 10225836;

  15. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409910

    Description: epitope description:QYIKANSKFIGITEL antigen name:Tetanus toxin host organism:Mus musculus C57BL/6

    Publication: 10225836;

  16. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409913

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C57BL/6

    Publication: 10225836;

  17. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409915

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C57BL/6

    Publication: 10225836;

  18. Epitopes of herpes simplex virus type 1 glycoprotein B that bind type-common neutralizing antibodies elicit type-specific antibody-dependent cellular ...

    ID: 1410106

    Description: epitope description:APSSPGTPGVAAATQAANGG antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1817

    Publication: 1380051;

  19. Epitopes of herpes simplex virus type 1 glycoprotein B that bind type-common neutralizing antibodies elicit type-specific antibody-dependent cellular ...

    ID: 1410116

    Description: epitope description:YREGSHTEHTSYAADRFKQVDGFYAR antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1819

    Publication: 1380051;

  20. Epitopes of herpes simplex virus type 1 glycoprotein B that bind type-common neutralizing antibodies elicit type-specific antibody-dependent cellular ...

    ID: 1410178

    Description: epitope description:Y278 antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1435

    Publication: 1380051;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston