Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Parvovirus B19 empty capsids as antigen carriers for presentation of antigenic determinants of dengue 2 virus.

    ID: 1318473

    Description: epitope description:ITVNPIVTEKDSPVNIE antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 16941345;

  2. Enhancing the immunogenicity and modulating the fine epitope recognition of antisera to a helical group A streptococcal peptide vaccine candidate from...

    ID: 1318475

    Description: epitope description:ASREAKKQVEKALE antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

    Publication: 11940119;

  3. Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

    ID: 1318658

    Description: epitope description:DVVTKLPLAVMG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

    Publication: 8556499;

  4. Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

    ID: 1319223

    Description: epitope description:FLVNAWKSKKNP antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

    Publication: 8556499;

  5. Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

    ID: 1319247

    Description: epitope description:APEARQAIRSLT antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

    Publication: 8556499;

  6. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319323

    Description: epitope description:GPAATRTIGGSQAQTASGLVSMFSVGPSQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9094694;

  7. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319327

    Description: epitope description:GGPTRTIGGS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9094694;

  8. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319330

    Description: epitope description:GPTRTIGGSQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9094694;

  9. Antigenicity and immunogenicity of novel chimeric hepatitis B surface antigen particles with exposed hepatitis C virus epitopes.

    ID: 1319331

    Description: epitope description:ETHVTGGSAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 11160717;

  10. Antigenicity and immunogenicity of novel chimeric hepatitis B surface antigen particles with exposed hepatitis C virus epitopes.

    ID: 1319332

    Description: epitope description:ETHVTGGSAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 11160717;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston