Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Hepatitis C virus core region: helper T cell epitopes recognized by BALB/c and C57BL/6 mice.

    ID: 1312418

    Description: epitope description:EGRAWAQPGYPWPLYGNEGL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 7537326;

  2. Enhancing the immunogenicity and modulating the fine epitope recognition of antisera to a helical group A streptococcal peptide vaccine candidate from...

    ID: 1312421

    Description: epitope description:RVFPRGTVENPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR antibody name:anti-p161

    Publication: 11940119;

  3. Monoclonal antibodies to the hypervariable region 1 of hepatitis C virus capture virus and inhibit virus adsorption to susceptible cells in vitro.

    ID: 1312435

    Description: epitope description:YTTGGAQSHTLR antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 X C3H antibody name:5A2

    Publication: 10753706;

  4. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312519

    Description: epitope description:PHGGGWGQGGGTHNQWNKPSKPKTNLKHVA antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P4

    Publication: 16272297;

  5. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312520

    Description: epitope description:PHGGGWGQGGGTHNQWNKPSKPKTNLKHVA antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-PrP

    Publication: 16272297;

  6. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312536

    Description: epitope description:WNKPSKPKTNLKHVAGAAAAGAVVGGLGGY antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P5

    Publication: 16272297;

  7. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312543

    Description: epitope description:GAVVGGLGGYMLGSAMSRPMIHFGN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P6

    Publication: 16272297;

  8. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312544

    Description: epitope description:GAVVGGLGGYMLGSAMSRPMIHFGN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P6

    Publication: 16272297;

  9. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312546

    Description: epitope description:MLGSAMSRPMIHFGNDWEDRYYRENMYRYP antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P7

    Publication: 16272297;

  10. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312555

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSNQN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P8

    Publication: 16272297;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston