Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. In vivo and in vitro evidence that cross-reactive antibodies to C-terminus of hypervariable region 1 do not neutralize heterologous hepatitis C virus.

    ID: 1313023

    Description: epitope description:ASQKIQLI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2Aa, 2Ed, 9Dd, 9Gc, 11Gb, 18Hd, 18Ie

    Publication: 12163260;

  2. In vivo and in vitro evidence that cross-reactive antibodies to C-terminus of hypervariable region 1 do not neutralize heterologous hepatitis C virus.

    ID: 1313028

    Description: epitope description:ASQKIQLI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2Aa, 2Ed, 9Dd, 9Gc, 11Gb, 18Hd, 18Ie

    Publication: 12163260;

  3. Reactivity to B cell epitopes within hepatitis C virus core protein and hepatocellular carcinoma.

    ID: 1313070

    Description: epitope description:QKKNKRNTNRRPQDV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7528637;

  4. Reactivity to B cell epitopes within hepatitis C virus core protein and hepatocellular carcinoma.

    ID: 1313072

    Description: epitope description:GGVYLLPRRGPRLGV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7528637;

  5. Neutralizing linear epitopes of B19 parvovirus cluster in the VP1 unique and VP1-VP2 junction regions.

    ID: 1313074

    Description: epitope description:MSKKSGKWWESDDKFAKAVY antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7684458;

  6. Neutralizing linear epitopes of B19 parvovirus cluster in the VP1 unique and VP1-VP2 junction regions.

    ID: 1313076

    Description: epitope description:AKAVYQQFVEFYEKVTGTDL antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7684458;

  7. Identification of a variant A-specific neutralizing epitope on glycoprotein B (gB) of human herpesvirus-6 (HHV-6).

    ID: 1313199

    Description: epitope description:N347 antigen name:DNA replication helicase host organism:Mus musculus antibody name:87-y-13

    Publication: 8813034;

  8. Disruption of anthrax toxin binding with the use of human antibodies and competitive inhibitors.

    ID: 1313299

    Description: epitope description:ETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEA...

    Publication: 10338505;

  9. Immunization with plasmid DNA encoding hepatitis C virus envelope E2 antigenic domains induces antibodies whose immune reactivity is linked to the inj...

    ID: 1313312

    Description: epitope description:IQLINTDGSWHINRTALNCNASHNTGW antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9261444;

  10. Immunization with plasmid DNA encoding hepatitis C virus envelope E2 antigenic domains induces antibodies whose immune reactivity is linked to the inj...

    ID: 1313313

    Description: epitope description:IQLINTDGSWHINRTALNCNASHNTGW antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9261444;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston