Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Antiaggregating antibody raised against human PrP 106-126 recognizes pathological and normal isoforms of the whole prion protein.

    ID: 1313385

    Description: epitope description:KTNMKHMAGAAAAGAVVGGLG antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:mAb 2-40

    Publication: 12043842;

  2. Antiaggregating antibody raised against human PrP 106-126 recognizes pathological and normal isoforms of the whole prion protein.

    ID: 1313386

    Description: epitope description:KTNMKHMAGAAAAGAVVGGLG antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:mAb 2-40

    Publication: 12043842;

  3. Antiaggregating antibody raised against human PrP 106-126 recognizes pathological and normal isoforms of the whole prion protein.

    ID: 1313391

    Description: epitope description:KTNMKHMAGAAAAGAVVGGLG antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:mAb 2-40

    Publication: 12043842;

  4. Rabies virus glycoprotein as a carrier for anthrax protective antigen.

    ID: 1313398

    Description: epitope description:FHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKIL...

    Publication: 16820183;

  5. Characterization of monoclonal antibodies that specifically recognize the palm subdomain of hepatitis C virus nonstructural protein 5B polymerase.

    ID: 1313611

    Description: epitope description:DSTVTENDIRVEESIYQCCDLAPEARQAIKSLTERLY antigen name:Genome polyprotein host organism:Mus musculus antibody name:16A9C

    Publication: 11325472;

  6. Use of a novel hepatitis C virus (HCV) major-epitope chimeric polypeptide for diagnosis of HCV infection.

    ID: 1313617

    Description: epitope description:PGAKQNVQLINTNGSWHLNSTALNCNDSLNTGWLAGLFYH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10203493;

  7. Use of a novel hepatitis C virus (HCV) major-epitope chimeric polypeptide for diagnosis of HCV infection.

    ID: 1313625

    Description: epitope description:ILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDA antigen name:Genome polyprotein host organism:Mus musculus antibody name:C100c

    Publication: 10203493;

  8. Use of a novel hepatitis C virus (HCV) major-epitope chimeric polypeptide for diagnosis of HCV infection.

    ID: 1313627

    Description: epitope description:SRRFAQALPVWARPDYNPPLVETWKKPDYEPPVVHG antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 10203493;

  9. Use of a novel hepatitis C virus (HCV) major-epitope chimeric polypeptide for diagnosis of HCV infection.

    ID: 1313629

    Description: epitope description:KNKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTS antigen name:Genome polyprotein host organism:Mus musculus antibody name:C22c

    Publication: 10203493;

  10. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316657

    Description: epitope description:RANDVLWLSLTAAEYDQSTYGSSTGPVYVS antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston