Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316659

    Description: epitope description:STYGSSTGPVYVSDSVTLVNVATGAQAVAR antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  2. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316660

    Description: epitope description:PVYVSDSVTLVNVATGAQAVARSLDWTKVT antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  3. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316665

    Description: epitope description:VLPLRGKLSFWEAGTTKAGYPYNYNTTASD antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  4. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316675

    Description: epitope description:HTFDDFCPECRPLGLQGCAFQSTVAELQRL antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  5. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316677

    Description: epitope description:RPLGLQGCAFQSTVAELQRLKMKVGKTREL antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  6. Evaluation of the latency-associated nuclear antigen (ORF73) of Kaposi's sarcoma-associated herpesvirus by peptide mapping and bacterially expressed r...

    ID: 1316686

    Description: epitope description:RNRSPERCDLGDDLHLQ antigen name:Protein ORF73 host organism:Homo sapiens

    Publication: 10882613;

  7. Evaluation of the latency-associated nuclear antigen (ORF73) of Kaposi's sarcoma-associated herpesvirus by peptide mapping and bacterially expressed r...

    ID: 1316688

    Description: epitope description:DEQEQQEEQEQQEEQEQ antigen name:Protein ORF73 host organism:Homo sapiens

    Publication: 10882613;

  8. Evaluation of the latency-associated nuclear antigen (ORF73) of Kaposi's sarcoma-associated herpesvirus by peptide mapping and bacterially expressed r...

    ID: 1316695

    Description: epitope description:VLRTSPPHRPGVRMRRV antigen name:Protein ORF73 host organism:Homo sapiens

    Publication: 10882613;

  9. Modulation of proteinase-K resistant prion protein by prion peptide immunization.

    ID: 1316719

    Description: epitope description:ENMYRYPNQVYYRPVDQYSN antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 11477546;

  10. DNA-based selection and screening of peptide ligands.

    ID: 1316746

    Description: epitope description:KTRTHTNAT host organism:Homo sapiens antibody name:affinity-purified C17

    Publication: 9831038;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston