Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502620

    Description: epitope description:LILALYDFHGRDVDGFAQGTRTAAIVETVAR antigen name:capsid VP2 host organism:Gallus gallus Leghorn

    Publication: 10725425;

  2. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502621

    Description: epitope description:QGTRTAAIVETVARMFPDFRSEVSEKFGIDLAVSEE antigen name:capsid VP2 host organism:Gallus gallus Leghorn

    Publication: 10725425;

  3. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502622

    Description: epitope description:ETVARMFPDFRSEVSEKFGIDLAVSEESDELFVKKTMVSSFS antigen name:capsid VP2 host organism:Gallus gallus Leghorn

    Publication: 10725425;

  4. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502631

    Description: epitope description:RCDLYPDGNLWGMPCPTY host organism:Mus musculus antibody name:2F2

    Publication: 10725425;

  5. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502632

    Description: epitope description:NCNPLEKWCPTVEQTPWY host organism:Mus musculus antibody name:2F2

    Publication: 10725425;

  6. Production of mouse monoclonal antibodies against Helicobacter pylori Catalase and mapping the antigenic epitope by phage display library.

    ID: 1502648

    Description: epitope description:NHNDFRPMYTWR host organism:Mus musculus BALB/c antibody name:mAb C001

    Publication: 18241959;

  7. Production of mouse monoclonal antibodies against Helicobacter pylori Catalase and mapping the antigenic epitope by phage display library.

    ID: 1502649

    Description: epitope description:HYDFSIKETSLQ host organism:Mus musculus BALB/c antibody name:mAb C001

    Publication: 18241959;

  8. Characterisation of new monoclonal antibodies reacting with prions from both human and animal brain tissues.

    ID: 1502847

    Description: epitope description:MKHM antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus C57BL/6 antibody name:3F4

    Publication: 18657541;

  9. Hydropathic complementarity determines interaction of epitope (869)HITDTNNK(876) in Manduca sexta Bt-R(1) receptor with loop 2 of domain II of Bacillu...

    ID: 1502912

    Description: epitope description:RRPFNIGINNQQ antigen name:Other Bacillus thuringiensis protein host organism:Homo sapiens antibody name:scFv73

    Publication: 12050155;

  10. Characterisation of new monoclonal antibodies reacting with prions from both human and animal brain tissues.

    ID: 1502917

    Description: epitope description:YQRESQAYYQRGA antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Rb486

    Publication: 18657541;

  11. Molecular basis for Bacillus thuringiensis Cry1Ab toxin specificity: two structural determinants in the Manduca sexta Bt-R1 receptor interact with loo...

    ID: 1502935

    Description: epitope description:RRPFNIGINNQQ antigen name:Other Bacillus thuringiensis protein host organism:Homo sapiens antibody name:scFv73

    Publication: 12950175;

  12. Use of Luminex xMAP-derived Bio-Plex bead-based suspension array for specific detection of PPV W and characterization of epitopes on the coat protein ...

    ID: 1502937

    Description: epitope description:DEEDD antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2C3, 10G7

    Publication: 18722476;

  13. IgE-binding epitopes of the American cockroach Per a 3 allergen.

    ID: 1502957

    Description: epitope description:IPKGKKGGQAY antigen name:Per a 3 host organism:Homo sapiens

    Publication: 14510715;

  14. Th1 and Th2 indices of the immune response in pigs vaccinated against Taenia solium cysticercosis suggest various host immune strategies against the p...

    ID: 1502988

    Description: epitope description:GYYYPSDPNTFFYAPPYSA host organism:Sus scrofa antibody name:anti-S3Pvac

    Publication: 12814694;

  15. High affinity mimotope of the polysaccharide capsule of Cryptococcus neoformans identified from an evolutionary phage peptide library.

    ID: 1502997

    Description: epitope description:FGGETFTPDWMMEVAIDNE host organism:Mus musculus BALB/c antibody name:mAb 2H1

    Publication: 12471134;

  16. Ultrastructural localization and epitope mapping of the methyltransferase-like and helicase-like proteins of Beet yellows virus.

    ID: 1503000

    Description: epitope description:SRLLENET antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:4A5, 4A2

    Publication: 11458006;

  17. Construction and functional activities of chimeric mouse-human immunoglobulin G and immunoglobulin M antibodies against the Neisseria meningitidis Por...

    ID: 1503005

    Description: epitope description:DTNNN antigen name:Major outer membrane protein P.IA host organism:Mus musculus antibody name:151,F-9; 184,F-12

    Publication: 14500492;

  18. Construction and functional activities of chimeric mouse-human immunoglobulin G and immunoglobulin M antibodies against the Neisseria meningitidis Por...

    ID: 1503007

    Description: epitope description:DTNNN antigen name:Major outer membrane protein P.IA host organism:Mus musculus antibody name:151,F-9; 184,F-12

    Publication: 14500492;

  19. Ultrastructural localization and epitope mapping of the methyltransferase-like and helicase-like proteins of Beet yellows virus.

    ID: 1503008

    Description: epitope description:DDPF antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:1C4

    Publication: 11458006;

  20. Monoclonal antibodies against the adeno-associated virus type 2 (AAV-2) capsid: epitope mapping and identification of capsid domains involved in AAV-2...

    ID: 1503021

    Description: epitope description:KRVLEPLGL antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:A1

    Publication: 10982375;

  21. Monoclonal antibodies against the adeno-associated virus type 2 (AAV-2) capsid: epitope mapping and identification of capsid domains involved in AAV-2...

    ID: 1503024

    Description: epitope description:LNFGQTGDADSV antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:A69

    Publication: 10982375;

  22. Monoclonal antibodies against the adeno-associated virus type 2 (AAV-2) capsid: epitope mapping and identification of capsid domains involved in AAV-2...

    ID: 1503038

    Description: epitope description:SADNNNSEYSWT antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:C37-B

    Publication: 10982375;

  23. Monoclonal antibodies against the adeno-associated virus type 2 (AAV-2) capsid: epitope mapping and identification of capsid domains involved in AAV-2...

    ID: 1503039

    Description: epitope description:SADNNNSEYSWT antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:C37-B

    Publication: 10982375;

  24. Identification of an immunorelevant ORF2 epitope from porcine circovirus type 2 as a serological marker for experimental and natural infection.

    ID: 1503050

    Description: epitope description:GVGSSAVILDDNFVT antigen name:Capsid protein host organism:Sus scrofa

    Publication: 11504425;

  25. Identification of an immunorelevant ORF2 epitope from porcine circovirus type 2 as a serological marker for experimental and natural infection.

    ID: 1503051

    Description: epitope description:FTIDYFQPNNKRNQL antigen name:Capsid protein host organism:Sus scrofa

    Publication: 11504425;

  26. Identification of an immunorelevant ORF2 epitope from porcine circovirus type 2 as a serological marker for experimental and natural infection.

    ID: 1503052

    Description: epitope description:VDHVGLGTAFENSIY antigen name:Capsid protein host organism:Sus scrofa

    Publication: 11504425;

  27. Identification of an immunorelevant ORF2 epitope from porcine circovirus type 2 as a serological marker for experimental and natural infection.

    ID: 1503054

    Description: epitope description:TSNQRGVGSTVVILD antigen name:Capsid protein host organism:Sus scrofa

    Publication: 11504425;

  28. Identification of an immunorelevant ORF2 epitope from porcine circovirus type 2 as a serological marker for experimental and natural infection.

    ID: 1503058

    Description: epitope description:GVGSSAVILDDNFVT antigen name:Capsid protein host organism:Sus scrofa

    Publication: 11504425;

  29. Identification of an immunorelevant ORF2 epitope from porcine circovirus type 2 as a serological marker for experimental and natural infection.

    ID: 1503065

    Description: epitope description:GVGSSAVILDDNFVT antigen name:Capsid protein host organism:Sus scrofa

    Publication: 11504425;

  30. The effect of amino acid spacers on the antigenicity of dimeric peptide--inducing cross-reacting antibodies to a cell surface protein antigen of Strep...

    ID: 1503114

    Description: epitope description:TYEAALKQYEADL antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 11169138;

  31. Ultrastructural localization and epitope mapping of the methyltransferase-like and helicase-like proteins of Beet yellows virus.

    ID: 1503130

    Description: epitope description:TMVTPGEL antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:3C5, 4B4, 4C5

    Publication: 11458006;

  32. Ultrastructural localization and epitope mapping of the methyltransferase-like and helicase-like proteins of Beet yellows virus.

    ID: 1503132

    Description: epitope description:SREQLVEA antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:2A4

    Publication: 11458006;

  33. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503138

    Description: epitope description:FQNLQNHRIVQ antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  34. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503141

    Description: epitope description:IEAKPNTLVL antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  35. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503144

    Description: epitope description:VIQQGQA antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  36. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503149

    Description: epitope description:RVAKISMPVNTPGQF antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  37. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503153

    Description: epitope description:EIRRVLLEENAG antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  38. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503178

    Description: epitope description:LFEVKPDKKNPQLQD antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  39. Characterization of Norwalk virus GI specific monoclonal antibodies generated against Escherichia coli expressed capsid protein and the reactivity of ...

    ID: 1503355

    Description: epitope description:MMMASKDATSSVDGASGAGQLVPEVNTSDPLAMDPVAGSSTAV host organism:Mus musculus BALB/c antibody name:3E7, 4E6, 4F7, 7D2, 13F9, 1G9, 3D10, 4...

    Publication: 11710959;

  40. Characterization of Norwalk virus GI specific monoclonal antibodies generated against Escherichia coli expressed capsid protein and the reactivity of ...

    ID: 1503359

    Description: epitope description:GTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQ antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody nam...

    Publication: 11710959;

  41. Characterization of Norwalk virus GI specific monoclonal antibodies generated against Escherichia coli expressed capsid protein and the reactivity of ...

    ID: 1503369

    Description: epitope description:PVAGSSTAVATAGQVNPIDPWIINNFVQAPQGEFTISPNN antigen name:Capsid protein VP1 host organism:Mus musculus C57BL/6 antibody name:1B4, 1F6

    Publication: 11710959;

  42. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503569

    Description: epitope description:KITCFLTAAGYCNTE antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  43. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503571

    Description: epitope description:FLTAAGYCNTECTLK antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  44. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503572

    Description: epitope description:TAAGYCNTECTLKKG antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  45. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503574

    Description: epitope description:YCNTECTLKKGSSGY antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  46. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503576

    Description: epitope description:ECTLKKGSSGYCAWP antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  47. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503581

    Description: epitope description:YCAWPACYCYGLPDS antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  48. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503586

    Description: epitope description:GLPDSVKIWTSETNK antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  49. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503617

    Description: epitope description:SKGCKITCFLTAAGY antigen name:Toxin Ts4 host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-TsNTxP

    Publication: 11922945;

  50. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503622

    Description: epitope description:TAAGYCNTECTLKKG antigen name:Toxin Ts4 host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-TsNTxP

    Publication: 11922945;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston