Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "
  1. Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

    ID: 1314265

    Description: epitope description:HSAPLG antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 28

    Publication: 8126461;
  2. Human recombinant antibodies specific for hepatitis C virus core and envelope E2 peptides from an immune phage display library.

    ID: 1313778

    Description: epitope description:SGHMAWDMMNWSPT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8887487;
  3. Recombinant subunit ORF2.1 antigen and induction of antibody against immunodominant epitopes in the hepatitis E virus capsid protein.

    ID: 1313921

    Description: epitope description:TMDYPARAHTFDDFCPECRPLGLQGCAFQSTVAELQRLKMKVGKTREL antigen name:Capsid protein host organism:Rattus norvegicus

    Publication: 10686019;
  4. Syntheses of four peptides from the immunodominant region of hepatitis C viral pathogens using PS-TTEGDA support for the investigation of HCV infectio...

    ID: 1313923

    Description: epitope description:HTPGCVPCVREQNSSRCWVALTPTVA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10961543;
  5. Syntheses of four peptides from the immunodominant region of hepatitis C viral pathogens using PS-TTEGDA support for the investigation of HCV infectio...

    ID: 1313926

    Description: epitope description:RPSWGPTDPRRRSRNLGKVLDTLT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10961543;
  6. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1313941

    Description: epitope description:MSTNPKPQIK antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;
  7. Induction of hepatitis C virus E1 envelope protein-specific immune response can be enhanced by mutation of N-glycosylation sites.

    ID: 1314151

    Description: epitope description:YEVRNVSGMYHVTNDCSNSSIVYEAADMIMHTPGC antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 11711599;
  8. Induction of hepatitis C virus E1 envelope protein-specific immune response can be enhanced by mutation of N-glycosylation sites.

    ID: 1314153

    Description: epitope description:ITGHRMAWDMMMNWSPTTAL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 11711599;
  9. Analyses of Gerstmann-Straussler syndrome with 102Leu219Lys using monoclonal antibodies that specifically detect human prion protein with 219Glu.

    ID: 1314181

    Description: epitope description:E219 antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:#41, #71

    Publication: 10889337;
  10. Molecular basis for antibody cross-reactivity between the hepatitis C virus core protein and the host-derived GOR protein.

    ID: 1314184

    Description: epitope description:RGQKAKSNPNRPLPVPRN antigen name:Exonuclease GOR host organism:Homo sapiens antibody name:anti-HCV positive patient serum

    Publication: 7516270;

Displaying 10 of 1,510,353 results for " "