Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317564

Description: epitope description:ALEGAMNFSTADSAKI antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317565

Description: epitope description:NFSTADSAKIKTLEAE antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317569

Description: epitope description:AELEKALEGAMNFSTA antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317570

Description: epitope description:LEGAMNFSTADSAKIK antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317586

Description: epitope description:AEKADLEHQSQVLNAN antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317589

Description: epitope description:SLRRDLDASREAKKQL antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317591

Description: epitope description:KKQLEAEHQKLEEQNK antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317595

Description: epitope description:LRRDLDASREAKKQLE antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317598

Description: epitope description:HQKLEEQNKISEASRQ antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317602

Description: epitope description:SREAKKQVEKALEEAN antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317608

Description: epitope description:EKEKAELQAKLEAEAK antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317610

Description: epitope description:AEAKALKEKLAKQAEE antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317611

Description: epitope description:KEKLAKQAEELAKLRA antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317614

Description: epitope description:ASDSQTPDAKPGNKAV antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317616

Description: epitope description:NKAVPGKGQAPQAGTK antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

ID: 1317624

Description: epitope description:VMATAGVAAVVKRKEE antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317628

Description: epitope description:RNTNRRPQDVKF antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317630

Description: epitope description:PGGGQIVGGVYLLPRR antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317632

Description: epitope description:GRTWAQPGYPWP antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317635

Description: epitope description:LPGCSFSIFLLA antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317637

Description: epitope description:HRMAWNMMMNWSPT antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317653

Description: epitope description:PTDPRRRSRNLG antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317661

Description: epitope description:VLEDGVNYATGN antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317666

Description: epitope description:TNDCPNSSVVYE antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317667

Description: epitope description:SSVVYEAADAIL antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317672

Description: epitope description:VAVTPTVATRDG antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317679

Description: epitope description:GSVFLVGQLFTFSPRHH antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317681

Description: epitope description:SPRHHWTTQDCN antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317684

Description: epitope description:HITGHRMAWNMM antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317686

Description: epitope description:VAQLLRIP antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317690

Description: epitope description:AGIKYFSMVGN antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317692

Description: epitope description:GNWAKVLVV antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317697

Description: epitope description:TAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317698

Description: epitope description:LLTPGAKQNIQL antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317709

Description: epitope description:YANGSGLDERPY antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317711

Description: epitope description:CWHYPPRPCGIV antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317712

Description: epitope description:RPCGIVPAKSVC antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317717

Description: epitope description:NNTRPPLGNWFG antigen name:Genome polyprotein host organism:Homo sapiens

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317735

Description: epitope description:RGERCDLEDRDR antigen name:Genome polyprotein host organism:Homo sapiens

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317748

Description: epitope description:LSSKAV antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317749

Description: epitope description:SSKAVN antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317755

Description: epitope description:HIHSVW antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317765

Description: epitope description:EDTVTP antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317767

Description: epitope description:TVTPID antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317768

Description: epitope description:VTPIDT antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317775

Description: epitope description:IMAKNE antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317776

Description: epitope description:MAKNEV antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317796

Description: epitope description:LIVFPD antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317807

Description: epitope description:RVCEKM antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317808

Description: epitope description:VCEKMA antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

High prevalence of hypervariable region 1-specific and -cross-reactive CD4(+) T cells in HCV-infected individuals responsive to IFN-alpha treatment.

ID: 1317815

Description: epitope description:NTYVTGGSAGRAVAGFAGLLQPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317826

Description: epitope description:MALYDV antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317830

Description: epitope description:DVVSTL antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317849

Description: epitope description:FQYSPG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317850

Description: epitope description:QYSPGQ antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317863

Description: epitope description:TWKSKK antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317865

Description: epitope description:KSKKNP antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317871

Description: epitope description:MGFSYD antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317872

Description: epitope description:GFSYDT antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317881

Description: epitope description:DSTVTE antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317894

Description: epitope description:SIYQCC antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317897

Description: epitope description:QCCDLA antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317913

Description: epitope description:TERLYI antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317916

Description: epitope description:LYIGGP antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317920

Description: epitope description:GPLTNS antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317921

Description: epitope description:PLTNSK antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317925

Description: epitope description:SKGQNC antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317928

Description: epitope description:QNCGYR antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314262

Description: epitope description:HSAPLG antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 29

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314263

Description: epitope description:HSAPLG antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314265

Description: epitope description:HSAPLG antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 28

Human recombinant antibodies specific for hepatitis C virus core and envelope E2 peptides from an immune phage display library.

ID: 1313778

Description: epitope description:SGHMAWDMMNWSPT antigen name:Genome polyprotein host organism:Homo sapiens

Recombinant subunit ORF2.1 antigen and induction of antibody against immunodominant epitopes in the hepatitis E virus capsid protein.

ID: 1313921

Description: epitope description:TMDYPARAHTFDDFCPECRPLGLQGCAFQSTVAELQRLKMKVGKTREL antigen name:Capsid protein host organism:Rattus norvegicus

Syntheses of four peptides from the immunodominant region of hepatitis C viral pathogens using PS-TTEGDA support for the investigation of HCV infectio...

ID: 1313923

Description: epitope description:HTPGCVPCVREQNSSRCWVALTPTVA antigen name:Genome polyprotein host organism:Homo sapiens

Syntheses of four peptides from the immunodominant region of hepatitis C viral pathogens using PS-TTEGDA support for the investigation of HCV infectio...

ID: 1313926

Description: epitope description:RPSWGPTDPRRRSRNLGKVLDTLT antigen name:Genome polyprotein host organism:Homo sapiens

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1313941

Description: epitope description:MSTNPKPQIK antigen name:Genome polyprotein host organism:Pan troglodytes

Induction of hepatitis C virus E1 envelope protein-specific immune response can be enhanced by mutation of N-glycosylation sites.

ID: 1314151

Description: epitope description:YEVRNVSGMYHVTNDCSNSSIVYEAADMIMHTPGC antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Induction of hepatitis C virus E1 envelope protein-specific immune response can be enhanced by mutation of N-glycosylation sites.

ID: 1314153

Description: epitope description:ITGHRMAWDMMMNWSPTTAL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Analyses of Gerstmann-Straussler syndrome with 102Leu219Lys using monoclonal antibodies that specifically detect human prion protein with 219Glu.

ID: 1314181

Description: epitope description:E219 antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:#41, #71

Molecular basis for antibody cross-reactivity between the hepatitis C virus core protein and the host-derived GOR protein.

ID: 1314184

Description: epitope description:RGQKAKSNPNRPLPVPRN antigen name:Exonuclease GOR host organism:Homo sapiens antibody name:anti-HCV positive patient serum

Genetic drift in hypervariable region 1 of the viral genome in persistent hepatitis C virus infection.

ID: 1314216

Description: epitope description:HGVSGLTSLFS antigen name:Genome polyprotein host organism:Homo sapiens

Genetic drift in hypervariable region 1 of the viral genome in persistent hepatitis C virus infection.

ID: 1314220

Description: epitope description:SGLTSLFSAFSAQ antigen name:Genome polyprotein host organism:Homo sapiens

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314231

Description: epitope description:ANPPDH antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314235

Description: epitope description:NPPDHS antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 29

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314238

Description: epitope description:NPPDHS antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 5

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314241

Description: epitope description:PPDHSA antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 28

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314243

Description: epitope description:PPDHSA antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314244

Description: epitope description:PPDHSA antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 5

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314249

Description: epitope description:PDHSAP antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Mexico)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314278

Description: epitope description:APLGVT antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 5

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314299

Description: epitope description:VTRPSA antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 29

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314311

Description: epitope description:RPSAPP antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314312

Description: epitope description:RPSAPP antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Mexico)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314324

Description: epitope description:SAPPLP antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 5

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314340

Description: epitope description:PPLPHV antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Serologic evidence for a class I group A streptococcal infection among rheumatic fever patients.

ID: 1314342

Description: epitope description:SRKGLRRDLDASREAKKQVEK antigen name:UniProt:A2RGM0 host organism:Homo sapiens

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314346

Description: epitope description:PLPHVV antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314350

Description: epitope description:PLPHVV antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 5

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314352

Description: epitope description:LPHVVD antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 28

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314357

Description: epitope description:LPHVVD antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 29