Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314365

Description: epitope description:HVVDLP antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Mexico)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314366

Description: epitope description:HVVDLP antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314369

Description: epitope description:HVVDLP antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 29

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314383

Description: epitope description:DLPQLG antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 5

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314388

Description: epitope description:DLPQLG antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314392

Description: epitope description:LPQLGP antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 6

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314402

Description: epitope description:PQLGPR antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 5

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314404

Description: epitope description:QLGPRR antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 29

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314407

Description: epitope description:QLGPRR antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 5

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314411

Description: epitope description:ANQPGH antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 29

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314423

Description: epitope description:NQPGHL antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314426

Description: epitope description:NQPGHL antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 29

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314431

Description: epitope description:QPGHLA antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314434

Description: epitope description:PGHLAP antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 28

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314450

Description: epitope description:HLAPLG antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 29

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314451

Description: epitope description:HLAPLG antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Mexico)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314459

Description: epitope description:APLGEI antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 6

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314462

Description: epitope description:APLGEI antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 5

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314473

Description: epitope description:PLGEIR antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Mexico)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314478

Description: epitope description:LGEIRP antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 6

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314483

Description: epitope description:LGEIRP antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 28

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314485

Description: epitope description:GEIRPS antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Mexico)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314491

Description: epitope description:EIRPSA antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Mexico)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314492

Description: epitope description:EIRPSA antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 6

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314496

Description: epitope description:IRPSAP antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314497

Description: epitope description:IRPSAP antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 28

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314505

Description: epitope description:RPSAPP antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Mexico)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314517

Description: epitope description:SAPPLP antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314519

Description: epitope description:SAPPLP antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Mexico)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314520

Description: epitope description:APPLPP antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 6

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314523

Description: epitope description:APPLPP antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 29

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314524

Description: epitope description:APPLPP antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 28

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314526

Description: epitope description:PPLPPV antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314527

Description: epitope description:PPLPPV antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 6

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314532

Description: epitope description:PLPPVA antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 5

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314533

Description: epitope description:PLPPVA antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Mexico)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314554

Description: epitope description:PVADLP antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 29

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314558

Description: epitope description:VADLPQ antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 28

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314571

Description: epitope description:DLPQPG antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314572

Description: epitope description:DLPQPG antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 6

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314573

Description: epitope description:DLPQPG antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 29

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314575

Description: epitope description:LPQPGL antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 5

A prion protein epitope selective for the pathologically misfolded conformation.

ID: 1314771

Description: epitope description:YYR antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:1A12, 17D10,17D4, 16A18, 20A13,1A7, 3A2, 9A4,...

Antibody-selected mimics of hepatitis C virus hypervariable region 1 activate both primary and memory Th lymphocytes.

ID: 1314809

Description: epitope description:TTHTVGGSVARQVHSLTGLFSPGPQQK host organism:Homo sapiens

Antibody-selected mimics of hepatitis C virus hypervariable region 1 activate both primary and memory Th lymphocytes.

ID: 1314822

Description: epitope description:TTTTVGGQASHTTSSLTGLFSPGSQQN host organism:Homo sapiens

Antibody-selected mimics of hepatitis C virus hypervariable region 1 activate both primary and memory Th lymphocytes.

ID: 1314832

Description: epitope description:NTYVTGGSAGRAVAGFAGLLQPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

Antibody-selected mimics of hepatitis C virus hypervariable region 1 activate both primary and memory Th lymphocytes.

ID: 1314835

Description: epitope description:ETHVTGGSAASTTSTLTKLFMPGASQN antigen name:Genome polyprotein host organism:Homo sapiens

Antibody-selected mimics of hepatitis C virus hypervariable region 1 activate both primary and memory Th lymphocytes.

ID: 1314841

Description: epitope description:NTHVTGGVVARNAYRITTFLNPGPAQN antigen name:Genome polyprotein host organism:Homo sapiens

Antibody-selected mimics of hepatitis C virus hypervariable region 1 activate both primary and memory Th lymphocytes.

ID: 1314847

Description: epitope description:ETYIIGAATGRTTAGLTSLFSSGSQQN antigen name:Genome polyprotein host organism:Homo sapiens

Antibody-selected mimics of hepatitis C virus hypervariable region 1 activate both primary and memory Th lymphocytes.

ID: 1314848

Description: epitope description:ETHVTGGNAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301357

Description: epitope description:STRITAQAEGRGASTLTSLFTSGASQK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301381

Description: epitope description:STIVSGGTVARTTHSLASLFTQGASQK antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301383

Description: epitope description:STIVSGGTVARTTHSLASLFTQGASQK antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301392

Description: epitope description:STIVSGGTVARTTHSLASLFTQGASQK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301394

Description: epitope description:STIVSGGTVARTTHSLASLFTQGASQK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301436

Description: epitope description:ETRVTGGAAGHTAFGFASFLAPGAKQK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301469

Description: epitope description:NTYVTGGSAGRAVAGFAGLLQPGAKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301494

Description: epitope description:ETHSVGGSAAHTTSRFTSLFSPGPQQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301495

Description: epitope description:ETHSVGGSAAHTTSRFTSLFSPGPQQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301496

Description: epitope description:ETHSVGGSAAHTTSRFTSLFSPGPQQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301497

Description: epitope description:ETHSVGGSAAHTTSRFTSLFSPGPQQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301500

Description: epitope description:ETHSVGGSAAHTTSRFTSLFSPGPQQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301531

Description: epitope description:ETHVTGGSAASTTSTLTKLFMPGASQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301536

Description: epitope description:ETHVTGGSAASTTSTLTKLFMPGASQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301543

Description: epitope description:ETHVTGGSAASTTSTLTKLFMPGASQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301569

Description: epitope description:QTRTVGGANARNTYGLTTLFTTGPKQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301599

Description: epitope description:GTTTVGSAVSSTTYRFAGMFSQGAQQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301601

Description: epitope description:GTTTVGSAVSSTTYRFAGMFSQGAQQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301611

Description: epitope description:GTTTVGSAVSSTTYRFAGMFSQGAQQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301613

Description: epitope description:GTTTVGSAVSSTTYRFAGMFSQGAQQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301614

Description: epitope description:GTTTVGSAVSSTTYRFAGMFSQGAQQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301635

Description: epitope description:NTHTVGGTEGFATQRLTSLFALGPSQK antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301638

Description: epitope description:NTHTVGGTEGFATQRLTSLFALGPSQK antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301675

Description: epitope description:NTHVTGGVVARNAYRITTFLNPGPAQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301680

Description: epitope description:NTHVTGGVVARNAYRITTFLNPGPAQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301750

Description: epitope description:KTHVTGMVAGKNAHTLSSIFTSGPSQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301782

Description: epitope description:GTHVTGGKVAYTTQGFTSFFSRGPSQK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301798

Description: epitope description:ETYTSGGNAGHTMTGIVRFFAPGPKQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301802

Description: epitope description:ETYTSGGNAGHTMTGIVRFFAPGPKQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301808

Description: epitope description:ETYTSGGNAGHTMTGIVRFFAPGPKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301814

Description: epitope description:ETYTSGGNAGHTMTGIVRFFAPGPKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301844

Description: epitope description:STYSMGGAAAHNARGLTSLFSSGASQR antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301873

Description: epitope description:ETHVTGGSAGRSVLGIASFLTRGPKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301896

Description: epitope description:ETYIIGAATGRTTAGLTSLFSSGSQQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301927

Description: epitope description:ETHVTGGNAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301935

Description: epitope description:ETHVTGGNAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301936

Description: epitope description:ETHVTGGNAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301939

Description: epitope description:ETHVTGGNAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1301990

Description: epitope description:NTRVTGGVQSHTTRGFVGMFSLGPSQR antigen name:Genome polyprotein host organism:Homo sapiens

Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

ID: 1302006

Description: epitope description:NTRVTGGVQSHTTRGFVGMFSLGPSQR antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Mapping the prion protein using recombinant antibodies.

ID: 1302480

Description: epitope description:AMSRPMIHFGNDWEDRYYRENMYRY antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:D18

Mapping the prion protein using recombinant antibodies.

ID: 1302483

Description: epitope description:AMSRPMIHFGNDWEDRYYRENMYRY antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:D18

Advances in alfalfa mosaic virus-mediated expression of anthrax antigen in planta.

ID: 1309249

Description: epitope description:EGLKEVINDRYDMLN antigen name:Protective antigen host organism:Mus musculus BALB/c

Hepatitis E virus: identification of type-common epitopes.

ID: 1311986

Description: epitope description:ANQPGHLAPLGEIRPSAPPLPPVADLPQPGLRR antigen name:Protein ORF3 host organism:Macaca fascicularis antibody name:C-130

Hepatitis E virus: identification of type-common epitopes.

ID: 1311988

Description: epitope description:TFDYPGRAHTFDDFCPECRALGLQGCAFQSTVAELQRLKVKV antigen name:Capsid protein host organism:Macaca fascicularis antibody name:C-130

Hepatitis E virus: identification of type-common epitopes.

ID: 1311992

Description: epitope description:TLDYPARAHTFDDFCPECRPLGLQGCAFQSTVAELQRLKMKV antigen name:Capsid protein host organism:Macaca fascicularis antibody name:C-130

Hepatitis E virus: identification of type-common epitopes.

ID: 1311993

Description: epitope description:TLDYPARAHTFDDFCPECRPLGLQGCAFQSTVAELQRLKMKV antigen name:Capsid protein host organism:Macaca fascicularis antibody name:C-30

Monoclonal antibodies to the hypervariable region 1 of hepatitis C virus capture virus and inhibit virus adsorption to susceptible cells in vitro.

ID: 1311995

Description: epitope description:HTRVTGGVQG antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:30F1

Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

ID: 1312000

Description: epitope description:ALIEEGQRM antigen name:Genome polyprotein host organism:Homo sapiens

Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

ID: 1312010

Description: epitope description:AEMLKSKIQ antigen name:Genome polyprotein host organism:Homo sapiens