Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383677

    Description: epitope description:LDSWWTSLNFLGGS antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  2. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383687

    Description: epitope description:FLFILLLCLIFLLV antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  3. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383698

    Description: epitope description:PSCCCTKPTDGNCT antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  4. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383702

    Description: epitope description:PSSWAFAKYLWEWA antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  5. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383704

    Description: epitope description:WEWASVRFSWLSLL antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  6. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383709

    Description: epitope description:LSPTVWLSAIWMMW antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  7. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383714

    Description: epitope description:VSPFIPLLPIFFCL antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  8. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383715

    Description: epitope description:IPLLPIFFCLWVYI antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  9. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383717

    Description: epitope description:FISEAIIHVLHSR antigen name:Physeter catodon (sperm whale) protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  10. Neutralising human recombinant antibodies to human cytomegalovirus glycoproteins gB and gH.

    ID: 1383727

    Description: epitope description:AASEALDPHAFHLLLNTYGR antigen name:Envelope glycoprotein H host organism:Homo sapiens antibody name:human sera

    Publication: 12423777;

  11. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1383758

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Mus musculus antibody name:F376

    Publication: 2462893;

  12. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1383762

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  13. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1383885

    Description: epitope description:MQWNSTAFHQTLQDP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  14. Characterization and sequence analyses of antibody-selected antigenic variants of herpes simplex virus show a conformationally complex epitope on glyc...

    ID: 1384067

    Description: epitope description:D168 antigen name:Envelope glycoprotein H host organism:Mus musculus antibody name:LP11

    Publication: 1707982;

  15. RIVETS: the recombinant immunoglobulin and viral epitope tag system.

    ID: 1384069

    Description: epitope description:ETIYNTTLKY antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:8F9

    Publication: 16919678;

  16. Identification of polyclonal serum specificities with phage-display libraries.

    ID: 1384072

    Description: epitope description:TRVPRR host organism:Pan troglodytes antibody name:Chimpanzee sera

    Publication: 8783147;

  17. Production of hybrid phage displaying secreted aspartyl proteinase epitope of Candida albicans and its application for the diagnosis of disseminated c...

    ID: 1384172

    Description: epitope description:VKYTS antigen name:Candidapepsin-2 host organism:Homo sapiens

    Publication: 17472610;

  18. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384178

    Description: epitope description:PRVRGLYLPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  19. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384179

    Description: epitope description:PRVRGLYLPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  20. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384181

    Description: epitope description:QDPRVR antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston