Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Synthetic peptides corresponding to the F protein of RSV stimulate murine B and T cells but fail to confer protection.

    ID: 1435152

    Description: epitope description:ICLTRTDRGWFCD antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 1706591;

  2. Synthetic peptides corresponding to the F protein of RSV stimulate murine B and T cells but fail to confer protection.

    ID: 1435154

    Description: epitope description:ICLTRTDRGWFCD antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 1706591;

  3. Synthetic peptides corresponding to the F protein of RSV stimulate murine B and T cells but fail to confer protection.

    ID: 1435156

    Description: epitope description:YYVNKQEGKSLYVKG antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 1706591;

  4. Allergy to bovine beta-lactoglobulin: specificity of human IgE to tryptic peptides.

    ID: 1435163

    Description: epitope description:LIVTQTMK antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 10457108;

  5. Hypoallergenic variants of the major latex allergen Hev b 6.01 retaining human T lymphocyte reactivity.

    ID: 1435166

    Description: epitope description:EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD antigen name:Hev b 6 host organism:Homo sapiens antibody name:patient sera

    Publication: 15494541;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston