Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Schistosoma mansoni 28-kDa glutathione S-transferase and immunity against parasite fecundity and egg viability. Role of the amino- and carboxyl-termin...

    ID: 1500096

    Description: epitope description:ENLLASSPRLAKYLSNRPATPF antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Rattus norvegicus Fischer 344

    Publication: 8423348;

  2. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500097

    Description: epitope description:PAPQAPYQGYQEPPAPQAPY antigen name:Epstein-Barr nuclear antigen 6 host organism:Oryctolagus cuniculus antibody name:rabbit anti-p-6...

    Publication: 7595412;

  3. An influenza A vaccine based on tetrameric ectodomain of matrix protein 2.

    ID: 1500098

    Description: epitope description:SLLTEVETPIRNEWGCRCNDSS antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 18252707;

  4. Schistosoma mansoni 28-kDa glutathione S-transferase and immunity against parasite fecundity and egg viability. Role of the amino- and carboxyl-termin...

    ID: 1500103

    Description: epitope description:ENLLASSPRLAKYLSNRPATPF antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Mus musculus BALB/c

    Publication: 8423348;

  5. Non-immunized natural human heavy chain CDR3 repertoires allow the isolation of high affinity peptides mimicking a human influenza hemagglutinin epito...

    ID: 1500105

    Description: epitope description:YPYDVPDYA antigen name:Hemagglutinin host organism:Mus musculus antibody name:17/9

    Publication: 17936360;

  6. Non-immunized natural human heavy chain CDR3 repertoires allow the isolation of high affinity peptides mimicking a human influenza hemagglutinin epito...

    ID: 1500106

    Description: epitope description:YPYDVPDYA antigen name:Hemagglutinin host organism:Mus musculus antibody name:17/9

    Publication: 17936360;

  7. Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy.

    ID: 1500112

    Description: epitope description:KYLGFVQDAA antigen name:Hev b 1 host organism:Homo sapiens

    Publication: 11275264;

  8. Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy.

    ID: 1500114

    Description: epitope description:LQPGVDIIEG antigen name:Hev b 1 host organism:Homo sapiens

    Publication: 11275264;

  9. Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy.

    ID: 1500123

    Description: epitope description:YYIPLEAVKF antigen name:Hev b 3 host organism:Homo sapiens

    Publication: 11275264;

  10. Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy.

    ID: 1500127

    Description: epitope description:AVITWRALNK antigen name:Hev b 3 host organism:Homo sapiens

    Publication: 11275264;

  11. Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy.

    ID: 1500153

    Description: epitope description:LQPGVDIIEG antigen name:Hev b 1 host organism:Homo sapiens

    Publication: 11275264;

  12. Antibodies to E1b protein-derived peptides of enteric adenovirus type 40 are associated with celiac disease and dermatitis herpetiformis.

    ID: 1500155

    Description: epitope description:NKVSARGCTF antigen name:E1B 55 kDa protein host organism:Homo sapiens

    Publication: 7694817;

  13. Antibodies to E1b protein-derived peptides of enteric adenovirus type 40 are associated with celiac disease and dermatitis herpetiformis.

    ID: 1500156

    Description: epitope description:RGCTFYGCWK antigen name:E1B 55 kDa protein host organism:Homo sapiens

    Publication: 7694817;

  14. Antibodies to E1b protein-derived peptides of enteric adenovirus type 40 are associated with celiac disease and dermatitis herpetiformis.

    ID: 1500158

    Description: epitope description:GLVGRPKSKL antigen name:E1B 55 kDa protein host organism:Homo sapiens

    Publication: 7694817;

  15. Antibodies to E1b protein-derived peptides of enteric adenovirus type 40 are associated with celiac disease and dermatitis herpetiformis.

    ID: 1500159

    Description: epitope description:PKSKLSVKKC antigen name:E1B 55 kDa protein host organism:Homo sapiens

    Publication: 7694817;

  16. Antibodies to E1b protein-derived peptides of enteric adenovirus type 40 are associated with celiac disease and dermatitis herpetiformis.

    ID: 1500160

    Description: epitope description:SVKKCLFEKC antigen name:E1B 55 kDa protein host organism:Homo sapiens

    Publication: 7694817;

  17. Antibodies to E1b protein-derived peptides of enteric adenovirus type 40 are associated with celiac disease and dermatitis herpetiformis.

    ID: 1500171

    Description: epitope description:GRVSARGCTFVACWKGVVG antigen name:control protein E1B 55K host organism:Homo sapiens

    Publication: 7694817;

  18. Protection of swine from foot-and-mouth disease with one dose of an all-D retro peptide.

    ID: 1500183

    Description: epitope description:GSGVRGDFGSLAPRVARQL + D-aa(G1,S2,G3,V4,R5,G6,D7,F8,G9,S10,L11,A12,P13,R14,V15,A16,R17,Q18,L19) antigen name:Genome polyprotein hos...

    Publication: 10438060;

  19. Analysis and simulation of a neutralizing epitope of transmissible gastroenteritis virus.

    ID: 1500187

    Description: epitope description:NNSNDL antigen name:Spike glycoprotein host organism:Mus musculus antibody name:MAb 57.57

    Publication: 1693702;

  20. A single amino acid substitution in the S1 and S2 Spike protein domains determines the neutralization escape phenotype of SARS-CoV.

    ID: 1500212

    Description: epitope description:V601, D757 antigen name:Spike glycoprotein host organism:Mus musculus antibody name:SKOT3

    Publication: 18606245;

  21. A single amino acid substitution in the S1 and S2 Spike protein domains determines the neutralization escape phenotype of SARS-CoV.

    ID: 1500226

    Description: epitope description:Y442, A834 antigen name:Spike glycoprotein host organism:Mus musculus antibody name:SKOT20

    Publication: 18606245;

  22. Mimicry of a neutralizing epitope of the major outer membrane protein of Chlamydia trachomatis by anti-idiotypic antibodies.

    ID: 1500232

    Description: epitope description:SDVEGLQNDP host organism:Mus musculus BALB/c antibody name:11A12; 2D7

    Publication: 7507888;

  23. Mutants of the major ryegrass pollen allergen, Lol p 5, with reduced IgE-binding capacity: candidates for grass pollen-specific immunotherapy.

    ID: 1500263

    Description: epitope description:K197, F198, T199, V200 antigen name:Other Lolium perenne (perennial ryegrass) protein host organism:Homo sapiens

    Publication: 11782018;

  24. Mimicry of a neutralizing epitope of the major outer membrane protein of Chlamydia trachomatis by anti-idiotypic antibodies.

    ID: 1500319

    Description: epitope description:LDVTTLNPTI host organism:Mus musculus BALB/c

    Publication: 7507888;

  25. Monoclonal antibodies raised against the ORF3 protein of hepatitis E virus (HEV) can capture HEV particles in culture supernatant and serum but not th...

    ID: 1500324

    Description: epitope description:LGATSPSAPPLPPVVDLPQLGLRR antigen name:Protein ORF3 host organism:Mus musculus BALB/c antibody name:TA0503, TA0512, TA0523, TA0531,...

    Publication: 18679765;

  26. High affinity mimotope of the polysaccharide capsule of Cryptococcus neoformans identified from an evolutionary phage peptide library.

    ID: 1500328

    Description: epitope description:KMGEEFTPDWMMESDFQGW host organism:Mus musculus BALB/c antibody name:mAb 2H1

    Publication: 12471134;

  27. High affinity mimotope of the polysaccharide capsule of Cryptococcus neoformans identified from an evolutionary phage peptide library.

    ID: 1500329

    Description: epitope description:FGGETFTPDWMMEVAIDNE host organism:Mus musculus BALB/c antibody name:mAb 2H1

    Publication: 12471134;

  28. Mutants of the major ryegrass pollen allergen, Lol p 5, with reduced IgE-binding capacity: candidates for grass pollen-specific immunotherapy.

    ID: 1500388

    Description: epitope description:K82, K197, F198, T199, V200, G298, K300 antigen name:Other Lolium perenne (perennial ryegrass) protein host organism:Homo sapiens

    Publication: 11782018;

  29. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500393

    Description: epitope description:LTILVALALFLLAAH antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  30. Epitope mapping of allergen ovalbumin using biofunctionalized magnetic beads packed in microfluidic channels The first step towards epitope-based vacc...

    ID: 1500396

    Description: epitope description:HIATNAVLFFGR antigen name:Gal d 2 host organism:Oryctolagus cuniculus

    Publication: 18707690;

  31. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500405

    Description: epitope description:LALFLLAAHASARQQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  32. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500413

    Description: epitope description:AAHASARQQWELQGD antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  33. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500414

    Description: epitope description:AAHASARQQWELQGD antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  34. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500415

    Description: epitope description:AAHASARQQWELQGD antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  35. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500417

    Description: epitope description:HASARQQWELQGDRR antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  36. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500424

    Description: epitope description:RQQWELQGDRRCQSQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  37. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500426

    Description: epitope description:QWELQGDRRCQSQLE antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  38. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500428

    Description: epitope description:QWELQGDRRCQSQLE antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  39. Monoclonal antibody-defined epitope map of expressed rubella virus protein domains.

    ID: 1507826

    Description: epitope description:MEDLQKALEAQSRALRAGLAA antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:C1, C2, C8

    Publication: 1712855;

  40. Analysis of the neutralization epitopes on human rotavirus VP7 recognized by monotype-specific monoclonal antibodies.

    ID: 1507830

    Description: epitope description:G96, D97 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:K8-10C8

    Publication: 1714939;

  41. Analysis of the neutralization epitopes on human rotavirus VP7 recognized by monotype-specific monoclonal antibodies.

    ID: 1507839

    Description: epitope description:D97 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:K8-12G2

    Publication: 1714939;

  42. Immunogenicity of peptides coupled with multiple T-cell epitopes of a surface protein antigen of Streptococcus mutans.

    ID: 1507872

    Description: epitope description:TYEAALKQYEADLAA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.M

    Publication: 8690461;

  43. Immunogenicity of peptides coupled with multiple T-cell epitopes of a surface protein antigen of Streptococcus mutans.

    ID: 1507888

    Description: epitope description:TYEAALKQYEA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.M

    Publication: 8690461;

  44. Protective immune response to foot-and-mouth disease virus with VP1 expressed in transgenic plants.

    ID: 1507920

    Description: epitope description:RYSRNAVPNVRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 9445079;

  45. Protection of cattle and swine against foot-and-mouth disease, using biosynthetic peptide vaccines.

    ID: 1507959

    Description: epitope description:SASGSGVRGDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 2154148;

  46. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507968

    Description: epitope description:N94 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:3

    Publication: 1656083;

  47. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507971

    Description: epitope description:N147, L148 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:1, RV-4:5

    Publication: 1656083;

  48. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507972

    Description: epitope description:N147, L148 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:1, RV-4:5

    Publication: 1656083;

  49. Protection of cattle and swine against foot-and-mouth disease, using biosynthetic peptide vaccines.

    ID: 1507973

    Description: epitope description:SASGSGVRGDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Sus scrofa Yorkshire

    Publication: 2154148;

  50. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507985

    Description: epitope description:S147, L148 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:1

    Publication: 1656083;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston