Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Mapping the prion protein using recombinant antibodies.

    ID: 1302480

    Description: epitope description:AMSRPMIHFGNDWEDRYYRENMYRY antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:D18

    Publication: 9765500;

  2. Mapping the prion protein using recombinant antibodies.

    ID: 1302483

    Description: epitope description:AMSRPMIHFGNDWEDRYYRENMYRY antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:D18

    Publication: 9765500;

  3. Advances in alfalfa mosaic virus-mediated expression of anthrax antigen in planta.

    ID: 1309249

    Description: epitope description:EGLKEVINDRYDMLN antigen name:Protective antigen host organism:Mus musculus BALB/c

    Publication: 16236249;

  4. Hepatitis E virus: identification of type-common epitopes.

    ID: 1311986

    Description: epitope description:ANQPGHLAPLGEIRPSAPPLPPVADLPQPGLRR antigen name:Protein ORF3 host organism:Macaca fascicularis antibody name:C-130

    Publication: 1717709;

  5. Hepatitis E virus: identification of type-common epitopes.

    ID: 1311988

    Description: epitope description:TFDYPGRAHTFDDFCPECRALGLQGCAFQSTVAELQRLKVKV antigen name:Capsid protein host organism:Macaca fascicularis antibody name:C-130

    Publication: 1717709;

  6. Hepatitis E virus: identification of type-common epitopes.

    ID: 1311992

    Description: epitope description:TLDYPARAHTFDDFCPECRPLGLQGCAFQSTVAELQRLKMKV antigen name:Capsid protein host organism:Macaca fascicularis antibody name:C-130

    Publication: 1717709;

  7. Hepatitis E virus: identification of type-common epitopes.

    ID: 1311993

    Description: epitope description:TLDYPARAHTFDDFCPECRPLGLQGCAFQSTVAELQRLKMKV antigen name:Capsid protein host organism:Macaca fascicularis antibody name:C-30

    Publication: 1717709;

  8. Monoclonal antibodies to the hypervariable region 1 of hepatitis C virus capture virus and inhibit virus adsorption to susceptible cells in vitro.

    ID: 1311995

    Description: epitope description:HTRVTGGVQG antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:30F1

    Publication: 10753706;

  9. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1312000

    Description: epitope description:ALIEEGQRM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  10. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1312010

    Description: epitope description:AEMLKSKIQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston