Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Acute-phase-specific heptapeptide epitope for diagnosis of parvovirus B19 infection.

    ID: 1324007

    Description: epitope description:GDSSNTGAGKALTGLSTGTS antigen name:Capsid protein VP1 host organism:Homo sapiens

    Publication: 10565913;

  2. Acute-phase-specific heptapeptide epitope for diagnosis of parvovirus B19 infection.

    ID: 1324008

    Description: epitope description:GAGKALTGLSTGTSQNTRIS antigen name:Capsid protein VP1 host organism:Homo sapiens

    Publication: 10565913;

  3. Acute-phase-specific heptapeptide epitope for diagnosis of parvovirus B19 infection.

    ID: 1324022

    Description: epitope description:PPPQIFLKILPQSGPIGGIK antigen name:Capsid protein VP1 host organism:Homo sapiens

    Publication: 10565913;

  4. Acute-phase-specific heptapeptide epitope for diagnosis of parvovirus B19 infection.

    ID: 1324023

    Description: epitope description:QIFLKILPQSGPIGGIKSMG antigen name:Capsid protein VP1 host organism:Homo sapiens

    Publication: 10565913;

  5. Acute-phase-specific heptapeptide epitope for diagnosis of parvovirus B19 infection.

    ID: 1324024

    Description: epitope description:LKILPQSGPIGGIKSMGITT antigen name:Capsid protein VP1 host organism:Homo sapiens

    Publication: 10565913;

  6. Characterization of monoclonal antibodies and epitope mapping of the NS4 protein of hepatitis C virus.

    ID: 1324032

    Description: epitope description:VLYQEFDE antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3F11, 3F12

    Publication: 12095709;

  7. T- and B-cell responses to different hepatitis C virus antigens in patients with chronic hepatitis C infection and in healthy anti-hepatitis C virus--...

    ID: 1324053

    Description: epitope description:NKRNTNRRPQDVKFPGGGQIVGGVY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8855177;

  8. T- and B-cell responses to different hepatitis C virus antigens in patients with chronic hepatitis C infection and in healthy anti-hepatitis C virus--...

    ID: 1324085

    Description: epitope description:GYPWPLYGNEGCGWAGWLLSPRGSR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8855177;

  9. Intranasal vaccination with SfbI or M protein-derived peptides conjugated to diphtheria toxoid confers protective immunity against a lethal challenge ...

    ID: 1324089

    Description: epitope description:VETEDTKEPGVLMGGQSESVEFTKDTQTGM antigen name:UniProt:A2RC81 host organism:Mus musculus BALB/c

    Publication: 16828529;

  10. Acute-phase-specific heptapeptide epitope for diagnosis of parvovirus B19 infection.

    ID: 1323792

    Description: epitope description:TSVNSAEASTGAGGGGSNSV antigen name:Capsid protein VP1 host organism:Homo sapiens

    Publication: 10565913;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston