Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384331

    Description: epitope description:QHDVNFTQEVSRLNINLHFSKCGFPF antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  2. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384333

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHI antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  3. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384337

    Description: epitope description:LVQLTLQSTNYTCIVCIDRASLST antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  4. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384338

    Description: epitope description:STWHVLYSPNVSVPSSSSTP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  5. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384352

    Description: epitope description:CRFPNITNSHVPILQERPPLENRVLTGYGL host organism:Homo sapiens

    Publication: 1955565;

  6. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384360

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHI antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  7. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384383

    Description: epitope description:STTFHQTLQDPRVRGLYFPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  8. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384391

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  9. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384394

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  10. Monoclonal antibody against non-dominant epitopes of HBV e Ag was raised by antigen-antibody co-immunization.

    ID: 1384396

    Description: epitope description:LVSFGVWIRTPPAYRPPN antigen name:External core antigen host organism:Mus musculus antibody name:EWB

    Publication: 17408795;

  11. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384403

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  12. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384405

    Description: epitope description:PLGFFPDHQLDPAFGANSNNPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  13. Antigenic and functional analysis of a neutralization site of HSV-1 glycoprotein D.

    ID: 1384752

    Description: epitope description:S165 antigen name:Envelope glycoprotein D host organism:Mus musculus antibody name:DL11

    Publication: 2154881;

  14. Antigenic and functional analysis of a neutralization site of HSV-1 glycoprotein D.

    ID: 1384790

    Description: epitope description:S241 antigen name:Envelope glycoprotein D host organism:Mus musculus BALB/c antibody name:LP2

    Publication: 2154881;

  15. Human immune responses to the Plasmodium falciparum ring-infected erythrocyte surface antigen (Pf155/RESA) after a decrease in malaria transmission in...

    ID: 1384802

    Description: epitope description:EENVEHDAEENVEHDAEENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 8470778;

  16. Linear epitopes of the replication-activator protein of Epstein-Barr virus recognised by specific serum IgG in nasopharyngeal carcinoma.

    ID: 1384831

    Description: epitope description:QAPLPCVLWPVLPEPLPQGQLT antigen name:Trans-activator protein BZLF1 host organism:Homo sapiens

    Publication: 7750123;

  17. Linear epitopes of the replication-activator protein of Epstein-Barr virus recognised by specific serum IgG in nasopharyngeal carcinoma.

    ID: 1384833

    Description: epitope description:PQGQLTAYHVSTAPTGSWFSAP antigen name:Trans-activator protein BZLF1 host organism:Homo sapiens

    Publication: 7750123;

  18. Linear epitopes of the replication-activator protein of Epstein-Barr virus recognised by specific serum IgG in nasopharyngeal carcinoma.

    ID: 1384847

    Description: epitope description:EECDSELEIKRYKNRVASRKCR antigen name:Trans-activator protein BZLF1 host organism:Homo sapiens

    Publication: 7750123;

  19. Linear epitopes of the replication-activator protein of Epstein-Barr virus recognised by specific serum IgG in nasopharyngeal carcinoma.

    ID: 1384854

    Description: epitope description:LDVDSIIPRTPDVLHEDLLNF antigen name:Trans-activator protein BZLF1 host organism:Homo sapiens

    Publication: 7750123;

  20. Immunization with a synthetic multiepitope antigen induces humoral and cellular immune responses to hepatitis C virus in mice.

    ID: 1384860

    Description: epitope description:TGDFDSVID antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:anti-PCX3

    Publication: 17425431;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston