Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508075

    Description: epitope description:PPYVEPTAPQVL antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens

    Publication: 1537894;

  2. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508082

    Description: epitope description:GDYSPSCCTLTIGVSSYHSKPCNPAQPVCS antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  3. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508083

    Description: epitope description:TKKPNRNGGGYYSASYSDPGSLKCPVY antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  4. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508088

    Description: epitope description:LVQLTLQSTNYTCIVCIDRASLST antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  5. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508090

    Description: epitope description:STWHVLYSPNVSVPSSSSTP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  6. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508102

    Description: epitope description:LDLLFWEQGGLCKALQEQCRFP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  7. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508105

    Description: epitope description:GWGLNWDLGLSQWAREALQTGIT antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  8. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508107

    Description: epitope description:LAGPCILRQLRHLPSRVRYPHYSLIKPESSL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  9. Two different 8 kDa monomers are involved in the oligomeric organization of the native Echinococcus granulosus antigen B.

    ID: 1508114

    Description: epitope description:LKMFGEVKYFFERDPLGQKVVDLLKEL antigen name:AntigenB host organism:Mus musculus antibody name:AB10, BG10, DC11, EB7, EG9 and CB5

    Publication: 9226697;

  10. Serological responses of patients with ectopic pregnancy to epitopes of the Chlamydia trachomatis 60 kDa heat shock protein.

    ID: 1508116

    Description: epitope description:SANNDAEIGNLI antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 9619577;

  11. Serological responses of patients with ectopic pregnancy to epitopes of the Chlamydia trachomatis 60 kDa heat shock protein.

    ID: 1508119

    Description: epitope description:ATLVVNRIRGGF antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 9619577;

  12. Serological responses of patients with ectopic pregnancy to epitopes of the Chlamydia trachomatis 60 kDa heat shock protein.

    ID: 1508121

    Description: epitope description:ILPGGGTALIRC antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 9619577;

  13. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508135

    Description: epitope description:PSFPTQRTSKTLKVLTPPIT antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 8158021;

  14. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508148

    Description: epitope description:LQSSSFIFHKFQTKAYHPSF antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 8158021;

  15. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508149

    Description: epitope description:YHPSFLLSHGLIQYSSFHSL antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 8158021;

  16. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508161

    Description: epitope description:AEIRGERK antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR69

    Publication: 7519806;

  17. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508168

    Description: epitope description:DSWDHEQA antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR76

    Publication: 7519806;

  18. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508170

    Description: epitope description:SLVGDKLY antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR77

    Publication: 7519806;

  19. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508173

    Description: epitope description:AEIRGERK antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR69

    Publication: 7519806;

  20. Human parainfluenza virus type 2 phosphoprotein: mapping of monoclonal antibody epitopes and location of the multimerization domain.

    ID: 1508176

    Description: epitope description:MAEEPTYTTEQVDELIHAGLGTVDFFLSRPIDAQSSLGKGSIPPGVT antigen name:Human rubulavirus 2 protein host organism:Mus musculus antibody name:...

    Publication: 9191922;

  21. Analysis of the newly identified neutralization epitopes on VP7 of human rotavirus serotype 1.

    ID: 1508179

    Description: epitope description:Q104, D145, M217 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:K8-3C10

    Publication: 1703558;

  22. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508193

    Description: epitope description:SRSLPRQSLIQPPTFHPPSS antigen name:Protein Rex host organism:Homo sapiens

    Publication: 8158021;

  23. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508195

    Description: epitope description:MDTWNPPLGSTSQPCLFQTP antigen name:Protein Rex host organism:Homo sapiens

    Publication: 8158021;

  24. Immunogenicity of peptide-vaccine candidates predicted by molecular dynamics simulations.

    ID: 1508212

    Description: epitope description:TKDTNNNLCGN host organism:Mus musculus BALB/c

    Publication: 12729743;

  25. Immunogenicity of peptide-vaccine candidates predicted by molecular dynamics simulations.

    ID: 1508214

    Description: epitope description:TKDTNNNLCG + D-aa(C9) host organism:Mus musculus BALB/c

    Publication: 12729743;

  26. Immunogenicity of peptide-vaccine candidates predicted by molecular dynamics simulations.

    ID: 1508215

    Description: epitope description:TKDTNNNLCG + D-aa(C9) host organism:Mus musculus BALB/c

    Publication: 12729743;

  27. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508224

    Description: epitope description:SPGGLEPPSEKHFRETEV antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 8158021;

  28. Immunogenicity of peptide-vaccine candidates predicted by molecular dynamics simulations.

    ID: 1508233

    Description: epitope description:TKDTNNNLCGN host organism:Mus musculus BALB/c

    Publication: 12729743;

  29. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508242

    Description: epitope description:TGAPSLGDYVRPAYIVTPYW antigen name:Protein Rex host organism:Homo sapiens

    Publication: 8158021;

  30. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508243

    Description: epitope description:TGAPSLGDYVRPAYIVTPYW antigen name:Protein Rex host organism:Homo sapiens

    Publication: 8158021;

  31. Human parainfluenza virus type 2 phosphoprotein: mapping of monoclonal antibody epitopes and location of the multimerization domain.

    ID: 1508259

    Description: epitope description:ANDCISRPDTKTEFVTKIQAATTESQLNEIKRSIIRSAI antigen name:Human rubulavirus 2 protein host organism:Mus musculus antibody name:2-1A, 5A...

    Publication: 9191922;

  32. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508404

    Description: epitope description:STNPKPQRKTKRNTNRRPQD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  33. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508409

    Description: epitope description:PRGSRPSWGPTDPRRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  34. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508413

    Description: epitope description:LPGCSFSIFLLALLSCLTIPASA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  35. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508429

    Description: epitope description:SRGNHVSPTHYVPESDAAAR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  36. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508434

    Description: epitope description:KLYVCLNE antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR77

    Publication: 7519806;

  37. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508436

    Description: epitope description:TATKQAEAAAPVVESKWRA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  38. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508437

    Description: epitope description:KSKKCPMGFSYDTRCFDSTVTENDIRTEES antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  39. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508441

    Description: epitope description:VKFPGGGQIVGGVYLLPRRG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  40. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508442

    Description: epitope description:RKTSERSQPRGRRQPIPKARRPEGR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  41. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508448

    Description: epitope description:PPALPIWARPDYNPPLLESWKDPD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  42. Localization of antigenic domains on the major subunits of Bordetella pertussis serotype 2 and 3 fimbriae.

    ID: 1508470

    Description: epitope description:KVTNGSKSYTLRYLASYVK antigen name:Serotype 3 fimbrial subunit host organism:Mus musculus Porton

    Publication: 7512870;

  43. Fine mapping of a continuous epitope on VP7 of bluetongue virus using overlapping synthetic peptides and a random epitope library.

    ID: 1508477

    Description: epitope description:QYPALTA antigen name:Core protein VP7 host organism:Mus musculus BALB/c antibody name:D11, F10

    Publication: 7505073;

  44. Fine mapping of a continuous epitope on VP7 of bluetongue virus using overlapping synthetic peptides and a random epitope library.

    ID: 1508486

    Description: epitope description:QYPALTA antigen name:Core protein VP7 host organism:Mus musculus BALB/c antibody name:D11, F10

    Publication: 7505073;

  45. Fine mapping of a continuous epitope on VP7 of bluetongue virus using overlapping synthetic peptides and a random epitope library.

    ID: 1508487

    Description: epitope description:QYPALTA antigen name:Core protein VP7 host organism:Mus musculus BALB/c antibody name:D11, F10

    Publication: 7505073;

  46. Fine mapping of a continuous epitope on VP7 of bluetongue virus using overlapping synthetic peptides and a random epitope library.

    ID: 1508491

    Description: epitope description:QYPALTA antigen name:Core protein VP7 host organism:Mus musculus BALB/c antibody name:D11, F10

    Publication: 7505073;

  47. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508500

    Description: epitope description:FGMLPVPQQPMGPQ antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;

  48. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508501

    Description: epitope description:QPMGPQPMGPQPMEP antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;

  49. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508509

    Description: epitope description:FGMLPVPQQPMGPQ antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;

  50. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508510

    Description: epitope description:QPMEPQPLPMGPQ antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston