Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317936

Description: epitope description:RASGVL antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317939

Description: epitope description:GVLTTS antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317941

Description: epitope description:LTTSCG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317943

Description: epitope description:TSCGNT antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317948

Description: epitope description:TLTCYL antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317952

Description: epitope description:YLKASA antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317954

Description: epitope description:KASAAC antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317958

Description: epitope description:ACRAAK antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317962

Description: epitope description:AKLQDC antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317963

Description: epitope description:KLQDCT antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1317966

Description: epitope description:MSTNPKPQRKTK antigen name:Genome polyprotein host organism:Pan troglodytes

Prevention of hepatitis C virus infection in a chimpanzee by vaccination and epitope mapping of antiserum directed against hypervariable region 1.

ID: 1317970

Description: epitope description:GGVQGHVTST antigen name:Genome polyprotein host organism:Pan troglodytes

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317972

Description: epitope description:NLSSKAVNHIHS antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317974

Description: epitope description:FLVNTWKSKKNP antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Prevention of hepatitis C virus infection in a chimpanzee by vaccination and epitope mapping of antiserum directed against hypervariable region 1.

ID: 1318065

Description: epitope description:ASQKIQLV antigen name:Genome polyprotein host organism:Pan troglodytes

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318068

Description: epitope description:NSKNPVPVKKEAKLSEAEL antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318085

Description: epitope description:KVEEEHKKDHEKLE antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318091

Description: epitope description:DNPSSVPVKKAAELYDKIK antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318093

Description: epitope description:ESSTVKAESSTVKAESSTIS antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318094

Description: epitope description:ESSTVKAESSTVKAESSTIS antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318102

Description: epitope description:EAPKSHSISNNEQLINELND antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318110

Description: epitope description:TIITRDIARDPDKLRKIAEN antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318113

Description: epitope description:TEVKAAGQSAPKGTNVSADL antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318115

Description: epitope description:EETKNKELDKKNKELDSRVT antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318121

Description: epitope description:ADPQKQNSVSNDSVTINVYN antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318128

Description: epitope description:ADDHPGAVAARNDVLSGFS antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318137

Description: epitope description:HQLADAARREVLKGETVPA antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318140

Description: epitope description:DARSVNGEFPRHVKLKNEIE antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318141

Description: epitope description:DHSDLVAEKQRL antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318142

Description: epitope description:DHSDLVAEKQRL antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318143

Description: epitope description:LKMLNRDLEQAYNELSGEAH antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318148

Description: epitope description:NQTEPSQTHNRLYQERQRL antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318152

Description: epitope description:NDDITSMTPILSGVGPGNA antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318155

Description: epitope description:DNGKAIYERARERALQELGP antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318196

Description: epitope description:NSKTPAPAPAVPVKKEATKSKLSEAELH antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318199

Description: epitope description:RSQPRGRRQPIP antigen name:Genome polyprotein host organism:Pan troglodytes

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318209

Description: epitope description:NSKTPAPAPAVPVKKEATKSKLSEAELH antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318222

Description: epitope description:PYRLWHYPCTIN antigen name:Genome polyprotein host organism:Pan troglodytes

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318235

Description: epitope description:NSKNPVPVKKEAKLSEAEL antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318238

Description: epitope description:AEIKKPQADSAWNWPKEYNA antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318241

Description: epitope description:EAPKSHSISNNEQLINELND antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318243

Description: epitope description:TEVKAAGQSAPKGTNVSADL antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318244

Description: epitope description:TEVKAAGQSAPKGTNVSADL antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318249

Description: epitope description:AEIKKPQADSAWNWPKEYNA antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318253

Description: epitope description:AEIKKPQADSAWNWPKEYNA antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318260

Description: epitope description:DDKEKDPQYRALMGENQDLR antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318265

Description: epitope description:EAPKSHSISNNEQLINELND antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318269

Description: epitope description:EAPKSHSISNNEQLINELND antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318270

Description: epitope description:TEVKAAGQSAPKGTNVSADL antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318275

Description: epitope description:TEVKAAGQSAPKGTNVSADL antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

ID: 1318287

Description: epitope description:DNGKAIYERARERALQELGP antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318301

Description: epitope description:CGWAGWLLSPRG antigen name:Genome polyprotein host organism:Pan troglodytes

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318305

Description: epitope description:RSRNLGKVIDTL antigen name:Genome polyprotein host organism:Pan troglodytes

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318316

Description: epitope description:LLSCLTVPASA antigen name:Genome polyprotein host organism:Pan troglodytes

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318317

Description: epitope description:SGLYHVTNDCPN antigen name:Genome polyprotein host organism:Pan troglodytes

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318321

Description: epitope description:HTPGCVPCVREG antigen name:Genome polyprotein host organism:Pan troglodytes

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318322

Description: epitope description:NASRCWVAVTPT antigen name:Genome polyprotein host organism:Pan troglodytes

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318331

Description: epitope description:SPRHHWTTQDCN antigen name:Genome polyprotein host organism:Pan troglodytes

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318333

Description: epitope description:CSIYPGHITGHR antigen name:Genome polyprotein host organism:Pan troglodytes

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318336

Description: epitope description:VAQLLRIP antigen name:Genome polyprotein host organism:Pan troglodytes

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318343

Description: epitope description:KVLVVLL antigen name:Genome polyprotein host organism:Pan troglodytes

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318344

Description: epitope description:LFAGVDA antigen name:Genome polyprotein host organism:Pan troglodytes

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318354

Description: epitope description:LASCRRLTDFAQ antigen name:Genome polyprotein host organism:Pan troglodytes

Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

ID: 1318356

Description: epitope description:GWGPISYANGSG antigen name:Genome polyprotein host organism:Pan troglodytes

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1316172

Description: epitope description:WGVLAGIAYY antigen name:Genome polyprotein host organism:Homo sapiens

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1316177

Description: epitope description:YYSMVGNWAK antigen name:Genome polyprotein host organism:Pan troglodytes

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1316179

Description: epitope description:VGNWAKVLIV antigen name:Genome polyprotein host organism:Pan troglodytes

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1316181

Description: epitope description:AKVLIVALLF antigen name:Genome polyprotein host organism:Pan troglodytes

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1316189

Description: epitope description:TYTSGGAASH antigen name:Genome polyprotein host organism:Pan troglodytes

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1316204

Description: epitope description:NGSWHINRTA antigen name:Genome polyprotein host organism:Homo sapiens

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1316211

Description: epitope description:CNDSLHTGFL antigen name:Genome polyprotein host organism:Pan troglodytes

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1316223

Description: epitope description:PIDWFAQGWG antigen name:Genome polyprotein host organism:Pan troglodytes

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1316230

Description: epitope description:PDSPDQRPYC antigen name:Genome polyprotein host organism:Homo sapiens

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1316232

Description: epitope description:DQRPYCWHYA antigen name:Genome polyprotein host organism:Homo sapiens

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1316234

Description: epitope description:YCWHYAPRPG antigen name:Genome polyprotein host organism:Homo sapiens

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1316246

Description: epitope description:IPLVGAPLGG antigen name:Genome polyprotein host organism:Homo sapiens

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316250

Description: epitope description:QGGNIVDIDFDSVP antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti...

Modulation of proteinase-K resistant prion protein by prion peptide immunization.

ID: 1316289

Description: epitope description:SAMSRPMIHFGNDWEDRYYR antigen name:Major prion protein host organism:Mus musculus A/J

Modulation of proteinase-K resistant prion protein by prion peptide immunization.

ID: 1316298

Description: epitope description:ITIKQHTFTTTTKGENFTETD antigen name:Major prion protein host organism:Mus musculus A/J

Modulation of proteinase-K resistant prion protein by prion peptide immunization.

ID: 1316305

Description: epitope description:WNTGGSRYPGQGSPGGNRYP antigen name:Major prion protein host organism:Mus musculus C57BL/6

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316317

Description: epitope description:EEDTEEDKPK antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316322

Description: epitope description:EEDKPKYEQG antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316324

Description: epitope description:DKPKYEQGGN antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-GST...

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316327

Description: epitope description:YEQGGNIVDI antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-GST...

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316329

Description: epitope description:QGGNIVDIDF antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316339

Description: epitope description:DSVPQIHGQN antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-GST...

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316341

Description: epitope description:VPQIHGQNKG antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-GST...

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316351

Description: epitope description:NQSFEEDTEK antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-GST...

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316352

Description: epitope description:NQSFEEDTEK antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316364

Description: epitope description:IIEEDTNKDK antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316370

Description: epitope description:NKDKPSYQFG antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316373

Description: epitope description:PSYQFGGHNS antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-GST...

Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

ID: 1316374

Description: epitope description:PSYQFGGHNS antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1316393

Description: epitope description:GSGPDQRPYC antigen name:Genome polyprotein host organism:Pan troglodytes

Epitope mapping by negative selection of randomized antigen libraries displayed on filamentous phage.

ID: 1316520

Description: epitope description:RAWAYM host organism:Mus musculus BALB/c antibody name:MA-3G10

Synthetic peptide vaccines yield monoclonal antibodies to cellular and pathological prion proteins of ruminants.

ID: 1316527

Description: epitope description:MVKSHIGSWILVLFVA antigen name:Major prion protein host organism:Mus musculus

Antigenic features of prion proteins of sheep and of other mammalian species.

ID: 1316535

Description: epitope description:GGGGWGQGGSHSQWNK antigen name:Major prion protein host organism:Oryctolagus cuniculus Chinchilla antibody name:Ra anti 89-104

Synthetic peptide vaccines yield monoclonal antibodies to cellular and pathological prion proteins of ruminants.

ID: 1316559

Description: epitope description:SHSQWNKPSKPKTNMK antigen name:Major prion protein host organism:Mus musculus

Synthetic peptide vaccines yield monoclonal antibodies to cellular and pathological prion proteins of ruminants.

ID: 1316565

Description: epitope description:GNDYEDRYYRENMYRYPNQV antigen name:Major prion protein host organism:Mus musculus

Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

ID: 1316571

Description: epitope description:SELVIPSERLHYRNQGWRSVETSGVAEEEA antigen name:Capsid protein host organism:Mus musculus