A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

ID: 1384864

Description: epitope description:IVGGVYLLPR antigen name:Genome polyprotein host organism:Homo sapiens

A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

ID: 1384876

Description: epitope description:DVLLLNNTR antigen name:Genome polyprotein host organism:Homo sapiens

A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

ID: 1384877

Description: epitope description:WMNSTGFTK antigen name:Genome polyprotein host organism:Homo sapiens

A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

ID: 1384892

Description: epitope description:GVVCAAILR antigen name:Genome polyprotein host organism:Homo sapiens

A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

ID: 1384894

Description: epitope description:LTITQLLKR antigen name:Genome polyprotein host organism:Homo sapiens

A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

ID: 1384896

Description: epitope description:WLQSKLLPR antigen name:Genome polyprotein host organism:Homo sapiens

A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

ID: 1384902

Description: epitope description:KLTPPHSAK antigen name:Genome polyprotein host organism:Homo sapiens

A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

ID: 1384905

Description: epitope description:VMGSSYGFQY antigen name:Genome polyprotein host organism:Homo sapiens

A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

ID: 1384912

Description: epitope description:GVGIYLLPNR antigen name:Genome polyprotein host organism:Homo sapiens

Identification of an immunodominant sequential epitope in glycoprotein G of herpes simplex virus type 2 that is useful for serotype-specific diagnosis...

ID: 1385115

Description: epitope description:PEEFEGAGDGEPPEDDDS antigen name:Envelope glycoprotein G host organism:Homo sapiens

Molecular fine-specificity analysis of antibody responses to human cytomegalovirus and design of novel synthetic-peptide-based serodiagnostic assays.

ID: 1385392

Description: epitope description:TPTPVNPSTAPAPAPTPTFACCQTPVNGNSPWAPTAPLPGDM antigen name:Other Human betaherpesvirus 5 (Human cytomegalovirus) protein host organis...

Molecular fine-specificity analysis of antibody responses to human cytomegalovirus and design of novel synthetic-peptide-based serodiagnostic assays.

ID: 1385397

Description: epitope description:FLTEEPFQRGDPFDKNYVGNSGKSRGGG antigen name:DNA polymerase processivity factor host organism:Homo sapiens

Molecular fine-specificity analysis of antibody responses to human cytomegalovirus and design of novel synthetic-peptide-based serodiagnostic assays.

ID: 1385400

Description: epitope description:GGSLSSLANAGGLHDDG antigen name:DNA polymerase processivity factor host organism:Homo sapiens

Antibodies against heat shock protein 60 derived from Helicobacter pylori: diagnostic implications in cardiovascular disease.

ID: 1386143

Description: epitope description:QVATISAN antigen name:60 kDa chaperonin host organism:Homo sapiens

Antibodies against heat shock protein 60 derived from Helicobacter pylori: diagnostic implications in cardiovascular disease.

ID: 1386145

Description: epitope description:DELDVVEGMQFDRGYLS antigen name:60 kDa chaperonin host organism:Homo sapiens

A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

ID: 1386817

Description: epitope description:EPDKMTT host organism:Homo sapiens antibody name:patient #1 serum IgE

A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

ID: 1387369

Description: epitope description:AVTFSKG host organism:Homo sapiens antibody name:patient #1 serum IgE

A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

ID: 1387895

Description: epitope description:IKLPALF host organism:Homo sapiens antibody name:patient #2 serum IgE

A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

ID: 1387896

Description: epitope description:IKLPALF host organism:Homo sapiens antibody name:patient #2 serum IgE

Epstein-Barr virus nuclear antigen 1 linear epitopes that are reactive with immunoglobulin A (IgA) or IgG in sera from nasopharyngeal carcinoma patien...

ID: 1376855

Description: epitope description:AGAGGGAGGAGAGGGAGGAG antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens