Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316599

    Description: epitope description:LTAAEYDQSTYGSSTGPVYVSDSVTLVNVA antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  2. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316600

    Description: epitope description:STYGSSTGPVYVSDSVTLVNVATGAQAVAR antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  3. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316601

    Description: epitope description:PVYVSDSVTLVNVATGAQAVARSLDWTKVT antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  4. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316605

    Description: epitope description:TIQQYSKTFFVLPLRGKLSFWEAGTTKAGY antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  5. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316609

    Description: epitope description:NTTASDQLLVENAAGHRVAISTYTTSLGAG antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  6. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316610

    Description: epitope description:NAAGHRVAISTYTTSLGAGPVSISAVAVLA antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  7. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316619

    Description: epitope description:SVDMNSITSTDVRILVQPGIASELVIPSER antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  8. Synthetic peptide vaccines yield monoclonal antibodies to cellular and pathological prion proteins of ruminants.

    ID: 1316623

    Description: epitope description:NNFVHDCVNIT antigen name:Major prion protein host organism:Mus musculus

    Publication: 9568991;

  9. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316636

    Description: epitope description:RNLTPGNTNTRVSRYSSTARHRLRRGADGT antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  10. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316638

    Description: epitope description:TRVSRYSSTARHRLRRGADGTAELTTTAAT antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston