Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316642

    Description: epitope description:TAATRFMKDLYFTSTNGVGEIGRGIALTLF antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  2. Synthetic peptide vaccines yield monoclonal antibodies to cellular and pathological prion proteins of ruminants.

    ID: 1316643

    Description: epitope description:TVTTTTKGENFTETDIKI antigen name:Major prion protein host organism:Mus musculus

    Publication: 9568991;

  3. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316644

    Description: epitope description:LYFTSTNGVGEIGRGIALTLFNLADTLLGG antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  4. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316647

    Description: epitope description:SRPVVSANGEPTVKLYTSVENAQQDKGIAI antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  5. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316649

    Description: epitope description:PTVKLYTSVENAQQDKGIAIPHDIDLGESR antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  6. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316651

    Description: epitope description:QDKGIAIPHDIDLGESRVVIQDYDNQHEQD antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  7. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316652

    Description: epitope description:IDLGESRVVIQDYDNQHEQDRPTPSPAPSR antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  8. Multiple antigenic peptides facilitate generation of anti-prion antibodies.

    ID: 1327078

    Description: epitope description:DRYYREN antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:anti-MAP-2

    Publication: 15270846;

  9. Immunization with a tetraepitopic lipid core peptide vaccine construct induces broadly protective immune responses against group A streptococcus.

    ID: 1327094

    Description: epitope description:DNGKAIYERARERALQELGP antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

    Publication: 16703510;

  10. Immunization with a tetraepitopic lipid core peptide vaccine construct induces broadly protective immune responses against group A streptococcus.

    ID: 1327095

    Description: epitope description:DNGKAIYERARERALQELGP antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

    Publication: 16703510;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston