Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316599

    Description: epitope description:LTAAEYDQSTYGSSTGPVYVSDSVTLVNVA antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  2. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316600

    Description: epitope description:STYGSSTGPVYVSDSVTLVNVATGAQAVAR antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  3. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316601

    Description: epitope description:PVYVSDSVTLVNVATGAQAVARSLDWTKVT antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  4. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316605

    Description: epitope description:TIQQYSKTFFVLPLRGKLSFWEAGTTKAGY antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  5. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316609

    Description: epitope description:NTTASDQLLVENAAGHRVAISTYTTSLGAG antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  6. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316610

    Description: epitope description:NAAGHRVAISTYTTSLGAGPVSISAVAVLA antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  7. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316619

    Description: epitope description:SVDMNSITSTDVRILVQPGIASELVIPSER antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  8. Synthetic peptide vaccines yield monoclonal antibodies to cellular and pathological prion proteins of ruminants.

    ID: 1316623

    Description: epitope description:NNFVHDCVNIT antigen name:Major prion protein host organism:Mus musculus

    Publication: 9568991;

  9. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316636

    Description: epitope description:RNLTPGNTNTRVSRYSSTARHRLRRGADGT antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  10. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316638

    Description: epitope description:TRVSRYSSTARHRLRRGADGTAELTTTAAT antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  11. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316642

    Description: epitope description:TAATRFMKDLYFTSTNGVGEIGRGIALTLF antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  12. Synthetic peptide vaccines yield monoclonal antibodies to cellular and pathological prion proteins of ruminants.

    ID: 1316643

    Description: epitope description:TVTTTTKGENFTETDIKI antigen name:Major prion protein host organism:Mus musculus

    Publication: 9568991;

  13. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316644

    Description: epitope description:LYFTSTNGVGEIGRGIALTLFNLADTLLGG antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  14. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316647

    Description: epitope description:SRPVVSANGEPTVKLYTSVENAQQDKGIAI antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  15. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316649

    Description: epitope description:PTVKLYTSVENAQQDKGIAIPHDIDLGESR antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  16. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316651

    Description: epitope description:QDKGIAIPHDIDLGESRVVIQDYDNQHEQD antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  17. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316652

    Description: epitope description:IDLGESRVVIQDYDNQHEQDRPTPSPAPSR antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  18. Multiple antigenic peptides facilitate generation of anti-prion antibodies.

    ID: 1327078

    Description: epitope description:DRYYREN antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:anti-MAP-2

    Publication: 15270846;

  19. Immunization with a tetraepitopic lipid core peptide vaccine construct induces broadly protective immune responses against group A streptococcus.

    ID: 1327094

    Description: epitope description:DNGKAIYERARERALQELGP antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

    Publication: 16703510;

  20. Immunization with a tetraepitopic lipid core peptide vaccine construct induces broadly protective immune responses against group A streptococcus.

    ID: 1327095

    Description: epitope description:DNGKAIYERARERALQELGP antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

    Publication: 16703510;

  21. Immunization with a tetraepitopic lipid core peptide vaccine construct induces broadly protective immune responses against group A streptococcus.

    ID: 1327097

    Description: epitope description:EVLTRRQSQDPKYVTQRIS antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

    Publication: 16703510;

  22. Clearance and prevention of prion infection in cell culture by anti-PrP antibodies.

    ID: 1327119

    Description: epitope description:GTHNQWNKPSKPKTNLK antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:6D11

    Publication: 16817866;

  23. Clearance and prevention of prion infection in cell culture by anti-PrP antibodies.

    ID: 1327124

    Description: epitope description:GSAMSRPMIHF antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:7H6

    Publication: 16817866;

  24. Clearance and prevention of prion infection in cell culture by anti-PrP antibodies.

    ID: 1327142

    Description: epitope description:GSRYPGQGSPG antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:8B4

    Publication: 16817866;

  25. Clearance and prevention of prion infection in cell culture by anti-PrP antibodies.

    ID: 1327144

    Description: epitope description:ESQAYYDGRRSS antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:8F9

    Publication: 16817866;

  26. Glycosylation of immunodominant linear epitopes in the carboxy-terminal region of the caprine arthritis-encephalitis virus surface envelope enhances v...

    ID: 1327161

    Description: epitope description:KYQVIKVRAYTYGV antigen name:envelope polyprotein host organism:Capra hircus Saanen

    Publication: 15308714;

  27. Glycosylation of immunodominant linear epitopes in the carboxy-terminal region of the caprine arthritis-encephalitis virus surface envelope enhances v...

    ID: 1327163

    Description: epitope description:IEMPENYAKTRIIN antigen name:envelope polyprotein host organism:Capra hircus Saanen

    Publication: 15308714;

  28. Glycosylation of immunodominant linear epitopes in the carboxy-terminal region of the caprine arthritis-encephalitis virus surface envelope enhances v...

    ID: 1327169

    Description: epitope description:RRKRELSHTRKKR antigen name:envelope polyprotein host organism:Capra hircus Saanen

    Publication: 15308714;

  29. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327170

    Description: epitope description:LLESIVFLSC antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  30. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327177

    Description: epitope description:GTFDDKSFNE antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  31. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327182

    Description: epitope description:EEFKIELVLK antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  32. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327185

    Description: epitope description:SSNSYLSDLE antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  33. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327188

    Description: epitope description:KDAGSDLIWL antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  34. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327192

    Description: epitope description:DVAKVAALQN antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  35. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327197

    Description: epitope description:IYSNDPIPAN antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  36. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327201

    Description: epitope description:RAQEGAFLTG antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  37. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327203

    Description: epitope description:TGYIAAKLSK antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  38. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327215

    Description: epitope description:YIGSFADLEA antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  39. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327218

    Description: epitope description:SVATRMYSDE antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  40. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327222

    Description: epitope description:AAGLGGIGAI antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  41. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327223

    Description: epitope description:GGIGAIEVAK antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  42. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327228

    Description: epitope description:VDEDQAYLAP antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  43. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327229

    Description: epitope description:QAYLAPDNVI antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  44. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327233

    Description: epitope description:VGRALNIFTS antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  45. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327235

    Description: epitope description:TSNHLKTNTF antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  46. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327236

    Description: epitope description:LKTNTFEGGK antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  47. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327238

    Description: epitope description:GKLINYGLKE antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  48. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327239

    Description: epitope description:NYGLKEGVVG antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  49. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1327240

    Description: epitope description:KEGVVGFVRN antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  50. Glycosylation of immunodominant linear epitopes in the carboxy-terminal region of the caprine arthritis-encephalitis virus surface envelope enhances v...

    ID: 1327252

    Description: epitope description:IEMPENYAKTRIIN antigen name:envelope polyprotein host organism:Capra hircus Saanen

    Publication: 15308714;

  51. Characterization of the epitope of anti-lipoarabinomannan antibodies as the terminal hexaarabinofuranosyl motif of mycobacterial arabinans.

    ID: 1327533

    Description: epitope description:beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-yl group antigen ...

    Publication: 12368438;

  52. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327577

    Description: epitope description:GGGTHNQWNKPSKPKTNLKH antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:anti-(heat-treated)P...

    Publication: 15706401;

  53. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327578

    Description: epitope description:GGGTHNQWNKPSKPKTNLKH antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:anti-PrPc

    Publication: 15706401;

  54. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327588

    Description: epitope description:SAMSRPMIHFGNDWEDRYYR antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:anti-PrPc

    Publication: 15706401;

  55. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327592

    Description: epitope description:GNDWEDRYYRENMYRYPNQV antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:anti-PrPc

    Publication: 15706401;

  56. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327597

    Description: epitope description:YYRPVDQYSNQNNFVHDCVN antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:anti-PrPc

    Publication: 15706401;

  57. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327611

    Description: epitope description:DVKMMERVVEQMCVTQYQKE antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:anti-(heat-treated)P...

    Publication: 15706401;

  58. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327615

    Description: epitope description:GGGTHNQWNKPSKPKTNLKH antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:ICSM 35

    Publication: 15706401;

  59. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327652

    Description: epitope description:YHVTNDCPNSSIVYEAADAI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  60. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327657

    Description: epitope description:SIVYEAADAILHTPGCVPCV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  61. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327659

    Description: epitope description:LHTPGCVPCVREGNASRCWV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  62. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327661

    Description: epitope description:LHTPGCVPCVREGNASRCWV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  63. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327662

    Description: epitope description:REGNASRCWVAMTPTVATRD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  64. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327664

    Description: epitope description:REGNASRCWVAMTPTVATRD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  65. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327669

    Description: epitope description:AMTPTVATRDGKLPATQLRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  66. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327670

    Description: epitope description:GKLPATQLRRHIDLLVGSAT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  67. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327674

    Description: epitope description:HIDLLVGSATLCSALYVGDL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  68. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327707

    Description: epitope description:PQAILDMIAGAHWGVLAGIA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  69. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327712

    Description: epitope description:AHWGVLAGIAYFSMVGNWAK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  70. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327714

    Description: epitope description:YFSMVGNWAKVLVVLLLFAG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  71. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327716

    Description: epitope description:YFSMVGNWAKVLVVLLLFAG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  72. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327720

    Description: epitope description:VLVVLLLFAGVDAETH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  73. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327723

    Description: epitope description:VQLINTNGSWHLNSTALNCN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  74. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327726

    Description: epitope description:HLNSTALNCNDSLNTGWLAG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  75. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327729

    Description: epitope description:HLNSTALNCNDSLNTGWLAG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  76. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327740

    Description: epitope description:GCPERLASCRPLTDFDQGWG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  77. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327741

    Description: epitope description:GCPERLASCRPLTDFDQGWG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  78. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327745

    Description: epitope description:PLTDFDQGWGPISYANGSGP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  79. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327746

    Description: epitope description:PISYANGSGPDQRPYCWHY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  80. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328149

    Description: epitope description:VASRRRPTTAGAAPLTAVAPAHDTPPVPDV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  81. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328157

    Description: epitope description:DTPPVPDVDSRGAILRRQYNLSTSPLTSSV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  82. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328161

    Description: epitope description:ARATIRYRPLVPNAVGGYAISISFWPQTTT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  83. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328166

    Description: epitope description:SVDMNSITSTDVRILVQPGIASELVIPSER antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  84. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328171

    Description: epitope description:VIPSERLHYRNQGWRSVETSGVAEEEATSG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  85. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328176

    Description: epitope description:GSPVNSYTNTPYTGALGLLDFALELEFRNL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  86. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328178

    Description: epitope description:DFALELEFRNLTPGNTNTRVSRYSSTARHR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  87. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328193

    Description: epitope description:DYDNQHEQDRPTPSPAPSRPFSVLRANDVL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  88. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328194

    Description: epitope description:DRPTPSPAPSRPFSVLRANDVLWLSLTAAE antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  89. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328195

    Description: epitope description:APSRPFSVLRANDVLWLSLTAAEYDQSTYG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  90. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328197

    Description: epitope description:NAAGHRVAISTYTTSLGAGPVSISAVAVLA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  91. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328200

    Description: epitope description:LAPHSALALLEDTMDYPARAHTFDDFCPEC antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  92. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328207

    Description: epitope description:GSPVNSYTNTPYTGALGLLDFALELEFRNL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  93. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328211

    Description: epitope description:GNTNTRVSRYSSTARHRLRRGADGTAELTT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  94. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328225

    Description: epitope description:RANDVLWLSLTAAEYDQSTYGSSTGPVYVS antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  95. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328227

    Description: epitope description:STYGSSTGPVYVSDSVTLVNVATGAQAVAR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  96. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328229

    Description: epitope description:VLPLRGKLSFWEAGTTKAGYPYNYNTTASD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  97. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328233

    Description: epitope description:LAPHSALALLEDTMDYPARAHTFDDFCPEC antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  98. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328234

    Description: epitope description:LEDTMDYPARAHTFDDFCPECRPLGLQGCA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  99. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328235

    Description: epitope description:DYPARAHTFDDFCPECRPLGLQGCAFQSTV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  100. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328237

    Description: epitope description:FCPECRPLGLQGCAFQSTVAELQRLKMKVG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston