Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Mapping epitopes of neutralizing monoclonal antibodies using phage random peptide libraries.

    ID: 1507366

    Description: epitope description:VMRQECWWWPCNDLY host organism:Mus musculus BALB/c antibody name:C1.8

    Publication: 9281855;

  2. Mapping epitopes of neutralizing monoclonal antibodies using phage random peptide libraries.

    ID: 1507367

    Description: epitope description:HPWWTWVSDPNATQP host organism:Mus musculus BALB/c antibody name:C1.8

    Publication: 9281855;

  3. Adherence epitopes of Mycoplasma genitalium adhesin.

    ID: 1507408

    Description: epitope description:PVKDSSKQ antigen name:Adhesin P1 host organism:Mus musculus BALB/c antibody name:6F3

    Publication: 1383392;

  4. Adherence epitopes of Mycoplasma genitalium adhesin.

    ID: 1507415

    Description: epitope description:PVKDSSKQ antigen name:Adhesin P1 host organism:Mus musculus BALB/c antibody name:6F3

    Publication: 1383392;

  5. Localization of antigenic sites of the E2 glycoprotein of transmissible gastroenteritis coronavirus.

    ID: 1507444

    Description: epitope description:G543, V631 antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:1B.B5

    Publication: 2155284;

  6. Structural comparison and epitope analysis of outer-membrane protein PIA from strains of Neisseria gonorrhoeae with differing serovar specificities.

    ID: 1507456

    Description: epitope description:GTEKF antigen name:Membrane protein (UniProt:Q5F5V7) host organism:Mus musculus antibody name:5G9

    Publication: 7506294;

  7. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507466

    Description: epitope description:DQKPPSRQSQIESR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  8. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507473

    Description: epitope description:GPNLVLPDQK antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  9. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507474

    Description: epitope description:GPKRIRTGDR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  10. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507479

    Description: epitope description:RRWQQRNTPFY antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  11. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507487

    Description: epitope description:DQKPPSRQSQIESR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  12. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507489

    Description: epitope description:SPKRIGTGDR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  13. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507491

    Description: epitope description:YTHFAKAARFRR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  14. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507492

    Description: epitope description:EKSLTSLSE antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  15. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507497

    Description: epitope description:KLRERLKQR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  16. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507502

    Description: epitope description:GPKRIRTGDR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  17. Epitope analysis of soybean major allergen Gly m Bd 30K recognized by the mouse monoclonal antibody using overlapping peptides.

    ID: 1507504

    Description: epitope description:QGGCGRGWAFSATGAIEA antigen name:P34 probable thiol protease host organism:Mus musculus BALB/c antibody name:H6

    Publication: 8782415;

  18. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507511

    Description: epitope description:EKSLTSLSEVVLQNRRGLD antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  19. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507520

    Description: epitope description:TKLAQYQAELKRVQEANAA antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  20. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507526

    Description: epitope description:DLAAVKKANAANEADYQAK antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  21. A single peptide from the major outer membrane protein of Chlamydia trachomatis elicits T cell help for the production of antibodies to protective det...

    ID: 1507540

    Description: epitope description:GILWEGFGGDPCDPCTTWVDAISMRMGYYGDFVFDRVLKTDVNKEFQMGA antigen name:Major outer membrane porin, serovar D host organism:Mus musculus B...

    Publication: 1712817;

  22. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507541

    Description: epitope description:AYQKALAAYQAELKRVQEA antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  23. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507554

    Description: epitope description:AANNAANAALTAENTAIKK antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  24. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507558

    Description: epitope description:TNAANQAAYQKALAAYQAE antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  25. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507561

    Description: epitope description:IKQRNENAKATYEAALKQY antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  26. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507563

    Description: epitope description:AALTAENTAIKKRNADAKA antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  27. Isolation of an immunodominant IgE hapten from an epitope expression cDNA library. Dissection of the allergic effector reaction.

    ID: 1507564

    Description: epitope description:APYHFDLSGHAFGAM antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 7525573;

  28. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507565

    Description: epitope description:YDWLMF host organism:Mus musculus BALB/c antibody name:12A1

    Publication: 9034147;

  29. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507575

    Description: epitope description:LDWLWEWAEQ host organism:Mus musculus BALB/c antibody name:13F1

    Publication: 9034147;

  30. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507582

    Description: epitope description:AVWQWMWVEY host organism:Mus musculus BALB/c antibody name:12A1, 13F1, 21D2

    Publication: 9034147;

  31. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507590

    Description: epitope description:LRYVVWADDW host organism:Mus musculus BALB/c antibody name:12A1, 13F1, 21D2

    Publication: 9034147;

  32. Isolation of an immunodominant IgE hapten from an epitope expression cDNA library. Dissection of the allergic effector reaction.

    ID: 1507591

    Description: epitope description:NEEPIAPYHFDLSGHAFG antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 7525573;

  33. A single peptide from the major outer membrane protein of Chlamydia trachomatis elicits T cell help for the production of antibodies to protective det...

    ID: 1507620

    Description: epitope description:SASFNLVGLFGNNENQTKVSNGAFVPNMSLDQ antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1712817;

  34. A single peptide from the major outer membrane protein of Chlamydia trachomatis elicits T cell help for the production of antibodies to protective det...

    ID: 1507625

    Description: epitope description:TGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDAD antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1712817;

  35. Synthetic, immunological and structural studies on repeat unit peptides of Plasmodium falciparum antigens.

    ID: 1507655

    Description: epitope description:EENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Oryctolagus cuniculus

    Publication: 2090643;

  36. Two distinct subtypes of hepatitis C virus defined by antibodies directed to the putative core protein.

    ID: 1507661

    Description: epitope description:IPKARRPEGRTWAQPGY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1383117;

  37. Two distinct subtypes of hepatitis C virus defined by antibodies directed to the putative core protein.

    ID: 1507662

    Description: epitope description:IPKDRRSTGKSWGKPGY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1383117;

  38. Mapping of domains on the human parainfluenza virus type 2 nucleocapsid protein (NP) required for NP-phosphoprotein or NP-NP interaction.

    ID: 1507680

    Description: epitope description:MTDIDIVTGNITEGSYKGVELAKLGKQTLLTRFTSNEPVSSAGSAQDPNFKRGG antigen name:Human rubulavirus 2 protein host organism:Mus musculus antibod...

    Publication: 10466799;

  39. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507682

    Description: epitope description:RAVIWAWMWE host organism:Mus musculus BALB/c antibody name:12A1, 13F1

    Publication: 9034147;

  40. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507685

    Description: epitope description:RAVIWAWMWE host organism:Mus musculus BALB/c

    Publication: 9034147;

  41. Localization of antigenic sites on the surface glycoprotein of mouse hepatitis virus.

    ID: 1507686

    Description: epitope description:IPRSRQIDLQIG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:30B

    Publication: 1713262;

  42. Localization of antigenic sites on the surface glycoprotein of mouse hepatitis virus.

    ID: 1507687

    Description: epitope description:IPRSRQIDLQIG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:30B

    Publication: 1713262;

  43. Localization of antigenic sites on the surface glycoprotein of mouse hepatitis virus.

    ID: 1507688

    Description: epitope description:IPRSRQIDLQIG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:A1, A4

    Publication: 1713262;

  44. The humoral immune response to human T-cell lymphotropic virus type 1 envelope glycoprotein gp46 is directed primarily against conformational epitopes...

    ID: 1507690

    Description: epitope description:LALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLI antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:PRH-1

    Publication: 9882322;

  45. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507728

    Description: epitope description:TLLTLCPATCILPLGEPFS antigen name:p34 host organism:Mus musculus BALB/c

    Publication: 9637294;

  46. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507731

    Description: epitope description:SNEPPLSEFELPPIQTPGLS antigen name:p34 host organism:Mus musculus BALB/c

    Publication: 9637294;

  47. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507741

    Description: epitope description:SNDVTIDAWCPLCGPHERLQ antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  48. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507744

    Description: epitope description:ETHRINWTADGRPCGLNGTL antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  49. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507747

    Description: epitope description:PQGPRRLWINCPLPAVRAQ antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  50. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507749

    Description: epitope description:GPVSLSPFERSPFQPYQCQL antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston