Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

    ID: 1332600

    Description: epitope description:SAAYATSSFSSLFTRG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

    Publication: 10421665;

  2. Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

    ID: 1332629

    Description: epitope description:AVGYRASRTVSLFSPG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

    Publication: 10421665;

  3. The IgE-binding epitopes of rPar j 2, a major allergen of Parietaria judaica pollen, are heterogeneously recognized among allergic subjects.

    ID: 1332633

    Description: epitope description:EACGKVVQDIMPCLHFVKGEEKEPSKECCS antigen name:Par j 2 host organism:Homo sapiens

    Publication: 10753015;

  4. High non-protective, long-lasting antibody levels in malaria are associated with haplotype shifting in MHC-peptide-TCR complex formation: a new mechan...

    ID: 1332659

    Description: epitope description:TDVNRYRYSNNYEAIPHIS antigen name:DNAJ protein, putative host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 16483708;

  5. High non-protective, long-lasting antibody levels in malaria are associated with haplotype shifting in MHC-peptide-TCR complex formation: a new mechan...

    ID: 1332662

    Description: epitope description:WGEEKRASHTTPVLMEKPYY antigen name:Apical membrane antigen 1 host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 16483708;

  6. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324797

    Description: epitope description:QTRVTGGTAGHITSGLTSLFVRGPSQKIQLI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10191201;

  7. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324800

    Description: epitope description:QTRVTGGTAGHITSGLTSLFVRGPSQKIQLI antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 10191201;

  8. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324812

    Description: epitope description:QTHVTGGTQGYTTQGFVGLFTRGPSQKIQLV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10191201;

  9. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324814

    Description: epitope description:QTHVTGGTQGYTTQGFVGLFTRGPSQKIQLV antigen name:Genome polyprotein host organism:Mus musculus BDF1

    Publication: 10191201;

  10. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324822

    Description: epitope description:ATYTTGGTAGHYTSKFASLFSSGSSQKIQLI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10191201;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston