Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "
  1. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324824

    Description: epitope description:ATYTTGGTAGHYTSKFASLFSSGSSQKIQLI antigen name:Genome polyprotein host organism:Mus musculus BDF1

    Publication: 10191201;
  2. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324833

    Description: epitope description:HTHVSGGAQAFTTRGFVGLFTTGPSQKIQLV antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 10191201;
  3. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324894

    Description: epitope description:TLRGVTSFFSPGASQKIQLI antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 10191201;
  4. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324942

    Description: epitope description:VTSTLTSLFRPGASQKIQLV antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 10191201;
  5. Functional analysis of Bacillus anthracis protective antigen by using neutralizing monoclonal antibodies.

    ID: 1325074

    Description: epitope description:SKNLAPI antigen name:Protective antigen host organism:Mus musculus BP2 antibody name:mAb 48.3

    Publication: 15501759;
  6. Detection of prion protein using a capillary electrophoresis-based competitive immunoassay with laser-induced fluorescence detection and cyclodextrin-...

    ID: 1325521

    Description: epitope description:GSDYEDRYYRENMHRYPNQ antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:12F10

    Publication: 15815999;
  7. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325659

    Description: epitope description:VGGVYLLPRRGPRLGVRAIR antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 8867614;
  8. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325666

    Description: epitope description:DVKFPGGGQIVGGVYLLPRR antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 8867614;
  9. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325677

    Description: epitope description:HTLTTGGHAARLTSGFAGLF antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 8867614;
  10. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325680

    Description: epitope description:KFDQGWGPITYAEPTKDPDQ antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 8867614;

Displaying 10 of 1,510,353 results for " "