Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

    ID: 1469483

    Description: epitope description:DVVDGMNFNRGY antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7679373;

  2. Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

    ID: 1469486

    Description: epitope description:SGIKDFLPVLQQ antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7679373;

  3. Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

    ID: 1469540

    Description: epitope description:GDRRKAMFEDIA antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7679373;

  4. Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

    ID: 1469544

    Description: epitope description:NEDEQIGARIVL antigen name:60 kDa chaperonin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7679373;

  5. Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

    ID: 1469545

    Description: epitope description:SAPLKQIAANAG antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7679373;

  6. Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

    ID: 1469550

    Description: epitope description:GAIIFQQVMSRS antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7679373;

  7. Chlamydia trachomatis major outer membrane protein epitopes expressed as fusions with LamB in an attenuated aro A strain of Salmonella typhimurium; th...

    ID: 1469595

    Description: epitope description:SAETIFDVTTLDPLNPTIAGAGDV host organism:Mus musculus C3H/He antibody name:Mouse anti-B1+B2 sera

    Publication: 1720166;

  8. Identification and localization of a limited number of predominant conformation-independent antibody epitopes of Theiler's murine encephalomyelitus vi...

    ID: 1470406

    Description: epitope description:FYSTNPDTTVPIYGKTISTPSDYMCGEFSDLL antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Mouse anti-TMEV a...

    Publication: 1371268;

  9. The amino terminus of human cytomegalovirus glycoprotein B contains epitopes that vary among strains.

    ID: 1470417

    Description: epitope description:ASTAAPPYTNEQAYQMLLAL antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:CH405-1, CH421-5

    Publication: 1378884;

  10. Induction of a protective immunity against Schistosoma mansoni with ovalbumin-coupled Sm37-5 coadsorbed with granulocyte-macrophage colony stimulating...

    ID: 1470467

    Description: epitope description:SGPLKGILEYTEDEVVSSDFVG antigen name:Glyceraldehyde-3-phosphate dehydrogenase host organism:Mus musculus CBA/J antibody name:mouse ...

    Publication: 10078602;

  11. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470585

    Description: epitope description:MSPQRDRINAFYKDN antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;

  12. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470588

    Description: epitope description:MSPQRDRINAFYKDN antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 7694357;

  13. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470593

    Description: epitope description:FYKDNPHPKGSRIVI antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;

  14. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470595

    Description: epitope description:SRIVINREHLMIDRP antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  15. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470599

    Description: epitope description:MIDRPYVLLAVLFVM antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  16. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470600

    Description: epitope description:MIDRPYVLLAVLFVM antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;

  17. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470609

    Description: epitope description:GLLAIAGIRLHRAAI antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;

  18. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470619

    Description: epitope description:TNSIEHQVKDVLTPL antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  19. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470621

    Description: epitope description:TNSIEHQVKDVLTPL antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  20. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470622

    Description: epitope description:TNSIEHQVKDVLTPL antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;

  21. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470645

    Description: epitope description:NPPERIKLDYDQYCA antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  22. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470646

    Description: epitope description:NPPERIKLDYDQYCA antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  23. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470649

    Description: epitope description:DQYCADVAAEELMNA antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  24. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470652

    Description: epitope description:ELMNALVNSTLLETR antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  25. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470659

    Description: epitope description:LAVSKGNCSGPTTIR antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  26. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470668

    Description: epitope description:MSLSLLDLYLGRGYN antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 7694357;

  27. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470673

    Description: epitope description:GRGYNVSSIVTMTSQ antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  28. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470674

    Description: epitope description:GRGYNVSSIVTMTSQ antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  29. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470675

    Description: epitope description:TMTSQGMYGGTYPVE antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 7694357;

  30. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470677

    Description: epitope description:TMTSQGMYGGTYPVE antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  31. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470680

    Description: epitope description:TYPVEKPNLSSKRSE antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;

  32. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470683

    Description: epitope description:SKRSELSQLSMYRVF antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 7694357;

  33. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470687

    Description: epitope description:MYRVFEVSVIRNPGL antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  34. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470688

    Description: epitope description:MYRVFEVSVIRNPGL antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  35. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470693

    Description: epitope description:RNPGLGAPVFHMTNY antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  36. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470694

    Description: epitope description:RNPGLGAPVFHMTNY antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 7694357;

  37. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470709

    Description: epitope description:HGEDSITIPYQGSGK antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 7694357;

  38. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470728

    Description: epitope description:QGSGKGVSFQLVKLG antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  39. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470731

    Description: epitope description:QGSGKGVSFQLVKLG antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;

  40. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470737

    Description: epitope description:TGMQSWVPLSTDDPV antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  41. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470741

    Description: epitope description:TDDPVIDRLYLSSHR antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 7694357;

  42. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470752

    Description: epitope description:RTDDKLRMETCFQQA antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;

  43. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470757

    Description: epitope description:CFQQACKGKIQALCE antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  44. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470758

    Description: epitope description:CFQQACKGKIQALCE antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 7694357;

  45. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470763

    Description: epitope description:QALCENPECVPLKDN antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  46. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470769

    Description: epitope description:GVLSVDLSLTVELKI antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  47. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470773

    Description: epitope description:VELKIKIASGFGPLI antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 7694357;

  48. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470778

    Description: epitope description:FGPLITHGSGMDLYK antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;

  49. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470779

    Description: epitope description:FGPLITHGSGMDLYK antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  50. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470801

    Description: epitope description:GEDCHAPTYLPAEVD antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 7694357;

  51. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470804

    Description: epitope description:PAEVDGDVKLSSNLV antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  52. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470807

    Description: epitope description:PAEVDGDVKLSSNLV antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 7694357;

  53. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470808

    Description: epitope description:SSNLVILPGQDLQYV antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  54. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470812

    Description: epitope description:DLQYVLATYDTSRVE antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 7694357;

  55. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470819

    Description: epitope description:TSRVEHAVVYYVYSP antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  56. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470830

    Description: epitope description:GVPIELQVECFTWDQ antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  57. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470838

    Description: epitope description:HFCVLADSESGGHIT antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  58. Mimotope of Leptospira from phage-displayed random peptide library is reactive with both monoclonal antibodies and patients' sera.

    ID: 1471138

    Description: epitope description:LTPCD antigen name:Other Leptospira interrogans protein host organism:Mus musculus BALB/c antibody name:mAb P20, P2, P4, P6, P7, P...

    Publication: 16581206;

  59. Identification and characterization of peptides mimicking the epitopes of metalloprotease of Schistosoma japonicum.

    ID: 1471152

    Description: epitope description:SNPPGMALSAPP host organism:Mus musculus Kunming

    Publication: 16212890;

  60. Structural features of envelope proteins on hepatitis C virus-like particles as determined by anti-envelope monoclonal antibodies and CD81 binding.

    ID: 1471155

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus antibody name:3/11

    Publication: 12093180;

  61. Identification and characterization of peptides mimicking the epitopes of metalloprotease of Schistosoma japonicum.

    ID: 1471159

    Description: epitope description:MEASHTHARPAP host organism:Mus musculus Kunming

    Publication: 16212890;

  62. Sex-dependent neutralizing humoral response to Schistosoma mansoni 28GST antigen in infected human populations.

    ID: 1471289

    Description: epitope description:YFDGRGRAESIRMTLVAAGVDYEDERISFQDWPK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 10823801;

  63. Mimotope of Leptospira from phage-displayed random peptide library is reactive with both monoclonal antibodies and patients' sera.

    ID: 1471316

    Description: epitope description:LTPCD antigen name:Other Leptospira interrogans protein host organism:Homo sapiens antibody name:Human sera

    Publication: 16581206;

  64. Mimotope of Leptospira from phage-displayed random peptide library is reactive with both monoclonal antibodies and patients' sera.

    ID: 1471348

    Description: epitope description:SSKSYR antigen name:Other Leptospira interrogans protein host organism:Mus musculus antibody name:mAb P1

    Publication: 16581206;

  65. Mimotope of Leptospira from phage-displayed random peptide library is reactive with both monoclonal antibodies and patients' sera.

    ID: 1471349

    Description: epitope description:KSGRC antigen name:Other Leptospira interrogans protein host organism:Mus musculus antibody name:mAb P2

    Publication: 16581206;

  66. Mimotope of Leptospira from phage-displayed random peptide library is reactive with both monoclonal antibodies and patients' sera.

    ID: 1471371

    Description: epitope description:SKSSRC antigen name:Other Leptospira interrogans protein host organism:Mus musculus antibody name:mAb F11

    Publication: 16581206;

  67. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471430

    Description: epitope description:SQTAKNNYVSQVYLHGDK antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  68. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471440

    Description: epitope description:PNCRIHSDNDCKFTL antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  69. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471442

    Description: epitope description:GSQVLATVAALAVSG antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  70. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471451

    Description: epitope description:QVYLHGDKTKPMILT antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  71. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471452

    Description: epitope description:PMILTITLNGTSEST antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  72. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471454

    Description: epitope description:STYSMSFTWSWESGK antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  73. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471455

    Description: epitope description:WESGKYTTETFATNS antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  74. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471458

    Description: epitope description:PNCRIHSDNDCKFTL antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  75. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471459

    Description: epitope description:CKFTLVLTKCGSQVL antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  76. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471468

    Description: epitope description:SQTAKNNYVSQVYLH antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  77. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471471

    Description: epitope description:STYSMSFTWSWESGK antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  78. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471472

    Description: epitope description:WESGKYTTETFATNS antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  79. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471493

    Description: epitope description:LTLWTTPAPSPNCRL antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  80. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471496

    Description: epitope description:GSQILATVSVLAVKG antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  81. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471503

    Description: epitope description:PNLSAYPKSHGKTAK antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  82. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471508

    Description: epitope description:AYSMSFSWDWSGHNY antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  83. T cell epitopes of house dust mite major allergen Der p II.

    ID: 1471618

    Description: epitope description:DQVDVKDCANHEIKK antigen name:Der p 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 7688399;

  84. T cell epitopes of house dust mite major allergen Der p II.

    ID: 1471643

    Description: epitope description:GQQYDIKYTWNVPK antigen name:Der p 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 7688399;

  85. T cell epitopes of house dust mite major allergen Der p II.

    ID: 1471649

    Description: epitope description:SENVVVTVKVMGDD antigen name:Der p 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 7688399;

  86. Distinct human T cell repertoires mediate immediate and delayed-type hypersensitivity to the Trichophyton antigen, Tri r 2.

    ID: 1471667

    Description: epitope description:DCNGHGTHVAGTVGGTKYGL antigen name:Subtilisin-like protease 6 host organism:Homo sapiens

    Publication: 11035075;

  87. Improvement of binding of Puumala virus neutralization site resembling peptide with a second-generation phage library.

    ID: 1471720

    Description: epitope description:FPCDRLSGYWERGIPSPCVR host organism:Homo sapiens antibody name:mAb 1C9

    Publication: 12874378;

  88. Improvement of binding of Puumala virus neutralization site resembling peptide with a second-generation phage library.

    ID: 1471722

    Description: epitope description:FPCDRLSGYWERGIPSPCVR host organism:Homo sapiens antibody name:mAb 1C9

    Publication: 12874378;

  89. Evaluation of the allergenicity and antigenicity of bovine-milk alphas1-casein using extensively purified synthetic peptides.

    ID: 1471843

    Description: epitope description:EAESISSSEEIVPNSVE antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 15541041;

  90. Evaluation of the allergenicity and antigenicity of bovine-milk alphas1-casein using extensively purified synthetic peptides.

    ID: 1471847

    Description: epitope description:YLGYLEQLLRLKKYKVPQLE antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 15541041;

  91. Evaluation of the allergenicity and antigenicity of bovine-milk alphas1-casein using extensively purified synthetic peptides.

    ID: 1471850

    Description: epitope description:VPQLEIVPNSAEERLHSMKE antigen name:Bos d 9 host organism:Oryctolagus cuniculus

    Publication: 15541041;

  92. Evaluation of the allergenicity and antigenicity of bovine-milk alphas1-casein using extensively purified synthetic peptides.

    ID: 1471860

    Description: epitope description:YVPLGTQYTDAPSFSDIPN antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 15541041;

  93. Evaluation of the allergenicity and antigenicity of bovine-milk alphas1-casein using extensively purified synthetic peptides.

    ID: 1471861

    Description: epitope description:YVPLGTQYTDAPSFSDIPN antigen name:Bos d 9 host organism:Oryctolagus cuniculus

    Publication: 15541041;

  94. IgE-mediated rat mast cell triggering with tryptic and synthetic peptides of bovine beta-lactoglobulin.

    ID: 1471871

    Description: epitope description:IDALNENK antigen name:Bos d 5 host organism:Rattus norvegicus

    Publication: 16220005;

  95. IgE-mediated rat mast cell triggering with tryptic and synthetic peptides of bovine beta-lactoglobulin.

    ID: 1471872

    Description: epitope description:VLVLDTDYK antigen name:Bos d 5 host organism:Rattus norvegicus

    Publication: 16220005;

  96. Mutational analysis of immunoglobulin E-binding epitopes of beta-casein and beta-lactoglobulin showed a heterogeneous pattern of critical amino acids ...

    ID: 1472048

    Description: epitope description:MPIQAFLLYQEP antigen name:Bos d 11 host organism:Homo sapiens

    Publication: 17517096;

  97. Mutational analysis of immunoglobulin E-binding epitopes of beta-casein and beta-lactoglobulin showed a heterogeneous pattern of critical amino acids ...

    ID: 1472094

    Description: epitope description:AQKKIIAEKTKI antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 17517096;

  98. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472105

    Description: epitope description:MMNHDTESHVKISRTIYRGVSPSTT antigen name:Putative paramyosin host organism:Mus musculus CBA antibody name:mouse serum

    Publication: 10924792;

  99. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472115

    Description: epitope description:CWAFSGVAATESAYLAHRNQSLDLAEQELVDCASQHGCHGDTIPRGI antigen name:Der p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 1940366;

  100. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472117

    Description: epitope description:LAHRNQSLDLAEQELVDCASQHGCH antigen name:Der p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 1940366;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston