Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

ID: 1332556

Description: epitope description:KAGSTVYAVTAVTSIFSVG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

ID: 1332558

Description: epitope description:KAGSTVYAVTAVTSIFSVG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

Temporal variations in immune responses to conserved regions of Plasmodium falciparum merozoite surface proteins related to the severity of a prior ma...

ID: 1332561

Description: epitope description:SNTFINNA antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Homo sapiens

Temporal variations in immune responses to conserved regions of Plasmodium falciparum merozoite surface proteins related to the severity of a prior ma...

ID: 1332563

Description: epitope description:NTSDSQKE antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Homo sapiens

Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

ID: 1332572

Description: epitope description:QAGRTAHAVTNIFSVG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

Human antibodies to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface protein 1 (MSP-1) exhibit a highly skewed, peptide-s...

ID: 1332574

Description: epitope description:KNQLAGKDEYEAKQKEAE antigen name:Heat shock 70 kDa protein host organism:Homo sapiens

Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

ID: 1332578

Description: epitope description:SAGRSTGSLVRLFAPG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

The most polymorphic residue on Plasmodium falciparum apical membrane antigen 1 determines binding of an invasion-inhibitory antibody.

ID: 1332580

Description: epitope description:E189 antigen name:Apical membrane antigen 1 host organism:Mus musculus antibody name:1F9

Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

ID: 1332583

Description: epitope description:SVGHMTGRFTSLFSVG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

ID: 1332590

Description: epitope description:SVGHMTGRFTSLFSVG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

ID: 1332600

Description: epitope description:SAAYATSSFSSLFTRG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

ID: 1332629

Description: epitope description:AVGYRASRTVSLFSPG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

The IgE-binding epitopes of rPar j 2, a major allergen of Parietaria judaica pollen, are heterogeneously recognized among allergic subjects.

ID: 1332633

Description: epitope description:EACGKVVQDIMPCLHFVKGEEKEPSKECCS antigen name:Par j 2 host organism:Homo sapiens

High non-protective, long-lasting antibody levels in malaria are associated with haplotype shifting in MHC-peptide-TCR complex formation: a new mechan...

ID: 1332659

Description: epitope description:TDVNRYRYSNNYEAIPHIS antigen name:DNAJ protein, putative host organism:Aotus nancymaae antibody name:Monkey sera

High non-protective, long-lasting antibody levels in malaria are associated with haplotype shifting in MHC-peptide-TCR complex formation: a new mechan...

ID: 1332662

Description: epitope description:WGEEKRASHTTPVLMEKPYY antigen name:Apical membrane antigen 1 host organism:Aotus nancymaae antibody name:Monkey sera

Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

ID: 1324797

Description: epitope description:QTRVTGGTAGHITSGLTSLFVRGPSQKIQLI antigen name:Genome polyprotein host organism:Homo sapiens

Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

ID: 1324800

Description: epitope description:QTRVTGGTAGHITSGLTSLFVRGPSQKIQLI antigen name:Genome polyprotein host organism:Pan troglodytes

Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

ID: 1324812

Description: epitope description:QTHVTGGTQGYTTQGFVGLFTRGPSQKIQLV antigen name:Genome polyprotein host organism:Homo sapiens

Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

ID: 1324814

Description: epitope description:QTHVTGGTQGYTTQGFVGLFTRGPSQKIQLV antigen name:Genome polyprotein host organism:Mus musculus BDF1

Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

ID: 1324822

Description: epitope description:ATYTTGGTAGHYTSKFASLFSSGSSQKIQLI antigen name:Genome polyprotein host organism:Homo sapiens

Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

ID: 1324824

Description: epitope description:ATYTTGGTAGHYTSKFASLFSSGSSQKIQLI antigen name:Genome polyprotein host organism:Mus musculus BDF1

Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

ID: 1324833

Description: epitope description:HTHVSGGAQAFTTRGFVGLFTTGPSQKIQLV antigen name:Genome polyprotein host organism:Pan troglodytes

Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

ID: 1324894

Description: epitope description:TLRGVTSFFSPGASQKIQLI antigen name:Genome polyprotein host organism:Pan troglodytes

Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

ID: 1324942

Description: epitope description:VTSTLTSLFRPGASQKIQLV antigen name:Genome polyprotein host organism:Pan troglodytes

Functional analysis of Bacillus anthracis protective antigen by using neutralizing monoclonal antibodies.

ID: 1325074

Description: epitope description:SKNLAPI antigen name:Protective antigen host organism:Mus musculus BP2 antibody name:mAb 48.3

Detection of prion protein using a capillary electrophoresis-based competitive immunoassay with laser-induced fluorescence detection and cyclodextrin-...

ID: 1325521

Description: epitope description:GSDYEDRYYRENMHRYPNQ antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:12F10

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325659

Description: epitope description:VGGVYLLPRRGPRLGVRAIR antigen name:Genome polyprotein host organism:Mus musculus

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325666

Description: epitope description:DVKFPGGGQIVGGVYLLPRR antigen name:Genome polyprotein host organism:Mus musculus

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325677

Description: epitope description:HTLTTGGHAARLTSGFAGLF antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325680

Description: epitope description:KFDQGWGPITYAEPTKDPDQ antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325703

Description: epitope description:RTALNCNDSLQTGFLAALFY antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325712

Description: epitope description:LTPRCMVDYPYRLWHYPCTV antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325717

Description: epitope description:DVKFPGGGQIVGGVYLLPRR antigen name:Genome polyprotein host organism:Homo sapiens

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325718

Description: epitope description:VGGVYLLPRRGPRLGVRAIR antigen name:Genome polyprotein host organism:Homo sapiens

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325719

Description: epitope description:GPRLGVRAIRKTSERSQPRG antigen name:Genome polyprotein host organism:Homo sapiens

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325721

Description: epitope description:RRQPIPKARRPEGRAWAQPG antigen name:Genome polyprotein host organism:Homo sapiens

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325728

Description: epitope description:HVTNDCSNSSIVFEAADLIM antigen name:Genome polyprotein host organism:Homo sapiens

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325731

Description: epitope description:EGNSSRCWVALTPTLAARNA antigen name:Genome polyprotein host organism:Homo sapiens

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325732

Description: epitope description:LTPTLAARNATIPTTTIRHH antigen name:Genome polyprotein host organism:Homo sapiens

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325733

Description: epitope description:TIPTTTIRHHVDLLVGAAAL antigen name:Genome polyprotein host organism:Homo sapiens

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325741

Description: epitope description:RLTSGFAGLFTPGPSQRIQL antigen name:Genome polyprotein host organism:Homo sapiens

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325748

Description: epitope description:KFDQGWGPITYAEPTKDPDQ antigen name:Genome polyprotein host organism:Homo sapiens

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325760

Description: epitope description:TDCFRKHPEATYSKCGSGPW antigen name:Genome polyprotein host organism:Homo sapiens

Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

ID: 1325761

Description: epitope description:TYSKCGSGPWLTPRCMVDYP antigen name:Genome polyprotein host organism:Homo sapiens

Identification of hepatitis C virus (HCV) 2a-derived epitope peptides having the capacity to induce cytotoxic T lymphocytes in human leukocyte antigen...

ID: 1325890

Description: epitope description:DFNASTDLL antigen name:Genome polyprotein host organism:Homo sapiens

Identification of hepatitis C virus (HCV) 2a-derived epitope peptides having the capacity to induce cytotoxic T lymphocytes in human leukocyte antigen...

ID: 1325894

Description: epitope description:VYHGAGNKTL antigen name:Genome polyprotein host organism:Homo sapiens

Identification of hepatitis C virus (HCV) 2a-derived epitope peptides having the capacity to induce cytotoxic T lymphocytes in human leukocyte antigen...

ID: 1325897

Description: epitope description:EFWEAVFTGL antigen name:Genome polyprotein host organism:Homo sapiens

Plasmid DNA and protein vaccination of mice to the outer surface protein A of Borrelia burgdorferi leads to induction of T helper cells with specifici...

ID: 1325901

Description: epitope description:ACKQNVSSLDEKNSVSVD antigen name:Outer surface protein A host organism:Mus musculus AKR

Immunological mimicry between retinal S-antigen and group A streptococcal M proteins.

ID: 1325904

Description: epitope description:TIGTLKKILDETVKDKIA antigen name:UniProt:A2RGM0 host organism:Mus musculus antibody name:B11A11

Immunological mimicry between retinal S-antigen and group A streptococcal M proteins.

ID: 1325908

Description: epitope description:DKLAKEQKSKQNIGALKQ antigen name:UniProt:A2RGM0 host organism:Mus musculus antibody name:B11A11, D9F2

Immunological mimicry between retinal S-antigen and group A streptococcal M proteins.

ID: 1325911

Description: epitope description:IYYHGEPIPVTVAVTNSTEK antigen name:S-arrestin host organism:Mus musculus antibody name:27.4.1, 36.2.2

Enhancing the immunogenicity and modulating the fine epitope recognition of antisera to a helical group A streptococcal peptide vaccine candidate from...

ID: 1325917

Description: epitope description:ASREAKKQVEKALE antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

Molecular analysis of human cardiac myosin-cross-reactive B- and T-cell epitopes of the group A streptococcal M5 protein.

ID: 1325956

Description: epitope description:TIGTLKKILDETVKDKIA antigen name:UniProt:A2RGM0 host organism:Mus musculus BALB/c antibody name:Mouse serum

Molecular analysis of human cardiac myosin-cross-reactive B- and T-cell epitopes of the group A streptococcal M5 protein.

ID: 1325965

Description: epitope description:SREAKKQLEAEQQKLEEQ antigen name:UniProt:A2RGM0 host organism:Mus musculus BALB/c antibody name:Mouse serum

Immune responses to the hepatitis C virus NS4A protein are profoundly influenced by the combination of the viral genotype and the host major histocomp...

ID: 1326002

Description: epitope description:LSGRPAIVPDREVLYQEFDE antigen name:Genome polyprotein host organism:Mus musculus B10.S

Immune responses to the hepatitis C virus NS4A protein are profoundly influenced by the combination of the viral genotype and the host major histocomp...

ID: 1326027

Description: epitope description:LSGQPAVIPDREVLYQQFDE antigen name:Genome polyprotein host organism:Mus musculus B10.M

Immune responses to the hepatitis C virus NS4A protein are profoundly influenced by the combination of the viral genotype and the host major histocomp...

ID: 1326029

Description: epitope description:LSGQPAVIPDREVLYQQFDE antigen name:Genome polyprotein host organism:Homo sapiens

Immune responses to the hepatitis C virus NS4A protein are profoundly influenced by the combination of the viral genotype and the host major histocomp...

ID: 1326034

Description: epitope description:LTGKPAVIPDREILYQQFDE antigen name:Genome polyprotein host organism:Mus musculus C57BL/10 X DBA/2

Immune responses to the hepatitis C virus NS4A protein are profoundly influenced by the combination of the viral genotype and the host major histocomp...

ID: 1326036

Description: epitope description:LTGKPAVIPDREILYQQFDE antigen name:Genome polyprotein host organism:Homo sapiens

Polyvalent synthetic vaccines: relationship between T epitopes and immunogenicity.

ID: 1326135

Description: epitope description:NFSTADSAKIKTLEAEKAALAARKADLEKALEGA antigen name:UniProt:A2RGM0 host organism:Cavia porcellus

Polyvalent synthetic vaccines: relationship between T epitopes and immunogenicity.

ID: 1326137

Description: epitope description:DYQGMLPVCPLIPGSSTTSTGPC antigen name:Large envelope protein host organism:Cavia porcellus

Confirmation of cross-reactivity between Lyme antibody H9724 and human heat shock protein 60 by a combinatorial approach.

ID: 1326145

Description: epitope description:MLQGVD + NAc(M1) antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Mus musculus antibody name:H...

Identification of a domain containing B-cell epitopes in hepatitis C virus E2 glycoprotein by using mouse monoclonal antibodies.

ID: 1326156

Description: epitope description:TWGENETDVLLLNNTRPPQ antigen name:Genome polyprotein host organism:Homo sapiens

Non-A, non-B hepatitis specific antibodies directed at host-derived epitope: implication for an autoimmune process.

ID: 1326263

Description: epitope description:GRRGQKAKSNPNRPL antigen name:Exonuclease GOR host organism:Homo sapiens antibody name:Human sera

A recombinant Escherichia coli heat-stable enterotoxin (STa) fusion protein eliciting anti-STa neutralizing antibodies.

ID: 1326265

Description: epitope description:NTFYCCELCCNPACAGCY antigen name:Heat-stable enterotoxin ST-IA/ST-P host organism:Oryctolagus cuniculus New Zealand White antibody ...

Mapping of linear B cell epitopes on open reading frames 2- and 3-encoded proteins of hepatitis E virus using synthetic peptides.

ID: 1326291

Description: epitope description:QSTVAELQRLKVKV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

Mapping of linear B cell epitopes on open reading frames 2- and 3-encoded proteins of hepatitis E virus using synthetic peptides.

ID: 1326293

Description: epitope description:LPPVADLPQPGLRR antigen name:Protein ORF3 host organism:Homo sapiens antibody name:Human sera

Mapping of linear B cell epitopes on open reading frames 2- and 3-encoded proteins of hepatitis E virus using synthetic peptides.

ID: 1326294

Description: epitope description:GVTRPSAPPLPHVV antigen name:Protein ORF3 host organism:Homo sapiens antibody name:Human sera

Recombinant staphylokinase variants with altered immunoreactivity. III: Species variability of antibody binding patterns.

ID: 1326341

Description: epitope description:K101 antigen name:Staphylokinase, putative host organism:Mus musculus BALB/c antibody name:30A2

Recombinant staphylokinase variants with altered immunoreactivity. III: Species variability of antibody binding patterns.

ID: 1326343

Description: epitope description:K101 antigen name:Staphylokinase, putative host organism:Papio

Recombinant staphylokinase variants with altered immunoreactivity. III: Species variability of antibody binding patterns.

ID: 1326357

Description: epitope description:E107 antigen name:Staphylokinase, putative host organism:Mus musculus BALB/c antibody name:7H11 and 24C4

Recombinant staphylokinase variants with altered immunoreactivity. III: Species variability of antibody binding patterns.

ID: 1326358

Description: epitope description:E107 antigen name:Staphylokinase, putative host organism:Oryctolagus cuniculus

Recombinant staphylokinase variants with altered immunoreactivity. III: Species variability of antibody binding patterns.

ID: 1326359

Description: epitope description:E107 antigen name:Staphylokinase, putative host organism:Papio

Recombinant staphylokinase variants with altered immunoreactivity. III: Species variability of antibody binding patterns.

ID: 1326360

Description: epitope description:E107 antigen name:Staphylokinase, putative host organism:Homo sapiens

Recombinant staphylokinase variants with altered immunoreactivity. III: Species variability of antibody binding patterns.

ID: 1326362

Description: epitope description:D109 antigen name:Staphylokinase, putative host organism:Oryctolagus cuniculus

Antigenicity of chimeric and cyclic synthetic peptides based on nonstructural proteins of GBV-C/HGV.

ID: 1326374

Description: epitope description:T1617, D1618, W1619, D1620, V1621, K1622, G1623, G1624, G1625, S1626, P1627, L1628, Y1629, R1630, H1631, G1632, D1633 antigen name...

Antigenicity of chimeric and cyclic synthetic peptides based on nonstructural proteins of GBV-C/HGV.

ID: 1326387

Description: epitope description:GTSGWAEVVVTPTHVD antigen name:polyprotein precursor host organism:Homo sapiens

Antigenicity of chimeric and cyclic synthetic peptides based on nonstructural proteins of GBV-C/HGV.

ID: 1326389

Description: epitope description:GTSGWAEVVVTPTHVDGGGGESAPSDAKTVTDAVD antigen name:Genome polyprotein host organism:Homo sapiens

Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

ID: 1326473

Description: epitope description:GCSFSIFLLALLSCLTVPAS antigen name:Genome polyprotein host organism:Homo sapiens

Towards a vaccine for rheumatic fever: identification of a conserved target epitope on M protein of group A streptococci.

ID: 1326479

Description: epitope description:KLNKELEESKKLTEKEKAEL antigen name:UniProt:A2RGM0 host organism:Homo sapiens antibody name:Human sera

Towards a vaccine for rheumatic fever: identification of a conserved target epitope on M protein of group A streptococci.

ID: 1326480

Description: epitope description:KLTEKEKAELQAKLEAEAKA antigen name:UniProt:A2RGM0 host organism:Homo sapiens antibody name:Human sera

Towards a vaccine for rheumatic fever: identification of a conserved target epitope on M protein of group A streptococci.

ID: 1326482

Description: epitope description:LKEQLAKQAEELAKLRAGKA antigen name:UniProt:A2RGM0 host organism:Homo sapiens antibody name:Human sera

Towards a vaccine for rheumatic fever: identification of a conserved target epitope on M protein of group A streptococci.

ID: 1326483

Description: epitope description:ELAKLRAGKASDSQTPDT antigen name:UniProt:A2RGM0 host organism:Homo sapiens antibody name:Human sera

Towards a vaccine for rheumatic fever: identification of a conserved target epitope on M protein of group A streptococci.

ID: 1326484

Description: epitope description:SDSQTPDTKPGNKAVPGKGQ antigen name:UniProt:A2RGM0 host organism:Homo sapiens antibody name:Human sera

Towards a vaccine for rheumatic fever: identification of a conserved target epitope on M protein of group A streptococci.

ID: 1326485

Description: epitope description:GNKAVPGKGQAPQAGTKPNQ antigen name:UniProt:A2RGM0 host organism:Homo sapiens antibody name:Human sera

Towards a vaccine for rheumatic fever: identification of a conserved target epitope on M protein of group A streptococci.

ID: 1326487

Description: epitope description:NKAPMKETKRQLPSTGETAN antigen name:UniProt:A2RGM0 host organism:Homo sapiens antibody name:Human sera

Towards a vaccine for rheumatic fever: identification of a conserved target epitope on M protein of group A streptococci.

ID: 1326489

Description: epitope description:PFFTAAALTVMATAGVAAVV antigen name:UniProt:A2RGM0 host organism:Homo sapiens antibody name:Human sera

Towards a vaccine for rheumatic fever: identification of a conserved target epitope on M protein of group A streptococci.

ID: 1326491

Description: epitope description:AVTRGTINDPQRAKEALDYE antigen name:UniProt:A2RGM0 host organism:Homo sapiens antibody name:Human sera

Towards a vaccine for rheumatic fever: identification of a conserved target epitope on M protein of group A streptococci.

ID: 1326494

Description: epitope description:LRRDLDASREAKKQVEKALE antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR antibody name:Anti-peptide 145

Towards a vaccine for rheumatic fever: identification of a conserved target epitope on M protein of group A streptococci.

ID: 1326498

Description: epitope description:LRRDLDASREAKKQVEKALE antigen name:UniProt:A2RGM0 host organism:Homo sapiens antibody name:Human Antibody

Production and characterization of neutralizing monoclonal antibodies that recognize an epitope in domain 2 of Bacillus anthracis protective antigen.

ID: 1326527

Description: epitope description:ASFFD antigen name:Protective antigen host organism:Mus musculus BALB/c antibody name:F20G77

Production and characterization of neutralizing monoclonal antibodies that recognize an epitope in domain 2 of Bacillus anthracis protective antigen.

ID: 1326528

Description: epitope description:ASFFD antigen name:Protective antigen host organism:Mus musculus BALB/c antibody name:F20G75

Production and characterization of neutralizing monoclonal antibodies that recognize an epitope in domain 2 of Bacillus anthracis protective antigen.

ID: 1326530

Description: epitope description:ASFFD antigen name:Protective antigen host organism:Mus musculus BALB/c antibody name:F20G77

Production and characterization of neutralizing monoclonal antibodies that recognize an epitope in domain 2 of Bacillus anthracis protective antigen.

ID: 1326536

Description: epitope description:ASFFD antigen name:Protective antigen host organism:Mus musculus BALB/c antibody name:F20G77

Mimotopes of the hepatitis C virus hypervariable region 1, but not the natural sequences, induce cross-reactive antibody response by genetic immunizat...

ID: 1326642

Description: epitope description:QTHTTGGQAGHQAHSLTGLFSPGAAKQN host organism:Oryctolagus cuniculus

Characterization of a unique borreliacidal epitope on the outer surface protein C of Borrelia burgdorferi.

ID: 1326953

Description: epitope description:TFTNKLKEKHTDLGK antigen name:Outer surface protein C host organism:Mus musculus BALB/c antibody name:16.22

Characterization of a unique borreliacidal epitope on the outer surface protein C of Borrelia burgdorferi.

ID: 1326963

Description: epitope description:TFTNKLKEKHTDLGK antigen name:Outer surface protein C host organism:Mus musculus BALB/c antibody name:16.22

Characterization of mimotopes mimicking an immunodominant conformational epitope on the hepatitis C virus NS3 helicase.

ID: 1326967

Description: epitope description:IFCHSKKKCDELAAKLVALG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3B1C4

A mutation in the envelope protein fusion loop attenuates mouse neuroinvasiveness of the NY99 strain of West Nile virus.

ID: 1326977

Description: epitope description:L107 antigen name:Genome polyprotein host organism:Mus musculus antibody name:3D9

Characterization of a unique borreliacidal epitope on the outer surface protein C of Borrelia burgdorferi.

ID: 1326979

Description: epitope description:TFTNKLKAKHTDLGK antigen name:Outer surface protein C host organism:Mus musculus BALB/c antibody name:16.22