Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506249

    Description: epitope description:CQVGSSNSAFVSTSSSRRYTEVYL antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  2. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506251

    Description: epitope description:CMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  3. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506266

    Description: epitope description:DDPPATVYRYDSRPPEDV antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  4. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506269

    Description: epitope description:CMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  5. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506270

    Description: epitope description:CQVGSSNSAFVSTSSSRRYTEVYL antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  6. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506271

    Description: epitope description:GALATYQSEYLAHRRIPP antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  7. Location of the Bombyx mori aminopeptidase N type 1 binding site on Bacillus thuringiensis Cry1Aa toxin.

    ID: 1506280

    Description: epitope description:NEVYIDRIEFVPAEVTFEAEYD antigen name:Other Bacillus thuringiensis protein host organism:Mus musculus BALB/c antibody name:1E10

    Publication: 16000811;

  8. The prevalence of coeliac disease antibodies in patients with the antiphospholipid syndrome.

    ID: 1506369

    Description: epitope description:KVSFFCKNKEKKCSY antigen name:Beta-2-glycoprotein 1 host organism:Homo sapiens

    Publication: 12765303;

  9. The prevalence of coeliac disease antibodies in patients with the antiphospholipid syndrome.

    ID: 1506370

    Description: epitope description:SCKLPVKKATVVYQGERVKIQ antigen name:Beta-2-glycoprotein 1 host organism:Homo sapiens

    Publication: 12765303;

  10. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506371

    Description: epitope description:VHTWTEQYK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.4-A1-C3 AND 1C6.3

    Publication: 18160621;

  11. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506384

    Description: epitope description:TRLENLMWK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 18160621;

  12. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506390

    Description: epitope description:LITVNPI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.3

    Publication: 18160621;

  13. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506400

    Description: epitope description:VDRGWGNGC antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.3

    Publication: 18160621;

  14. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506403

    Description: epitope description:PATVYRYDSRPPEDV antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  15. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506404

    Description: epitope description:PATVYRYDSRPPEDV antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  16. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506412

    Description: epitope description:YDSRPPEDV antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  17. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506416

    Description: epitope description:DDPPATVYRYDSRPP antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  18. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506464

    Description: epitope description:MAAWSERAGEAMVLVYYESIAYSF antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  19. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506479

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4

    Publication: 18160621;

  20. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506485

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4

    Publication: 18160621;

  21. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506487

    Description: epitope description:TTASGKLIT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.3

    Publication: 18160621;

  22. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506489

    Description: epitope description:TTASGKLIT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.3

    Publication: 18160621;

  23. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506506

    Description: epitope description:WHVLYSP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 15223246;

  24. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506525

    Description: epitope description:WHQLYSP host organism:Homo sapiens

    Publication: 15223246;

  25. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506527

    Description: epitope description:WHSMFAP host organism:Homo sapiens

    Publication: 15223246;

  26. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506541

    Description: epitope description:WHRLLAI host organism:Homo sapiens

    Publication: 15223246;

  27. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506547

    Description: epitope description:PHMNNFHL host organism:Homo sapiens

    Publication: 15223246;

  28. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506557

    Description: epitope description:PHMQLHHL host organism:Homo sapiens

    Publication: 15223246;

  29. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506560

    Description: epitope description:PQSNLAKT host organism:Homo sapiens

    Publication: 15223246;

  30. Monovalent fusion proteins of IgE mimotopes are safe for therapy of type I allergy.

    ID: 1506671

    Description: epitope description:CQQTLSVRALC host organism:Mus musculus BALB/c

    Publication: 11641259;

  31. Monovalent fusion proteins of IgE mimotopes are safe for therapy of type I allergy.

    ID: 1506673

    Description: epitope description:CQQTLSVRALC host organism:Homo sapiens

    Publication: 11641259;

  32. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506745

    Description: epitope description:PMWPME host organism:Equus caballus

    Publication: 9766888;

  33. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500430

    Description: epitope description:ELQGDRRCQSQLERA antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  34. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500558

    Description: epitope description:NNQRCMCEALQQIME antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  35. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500562

    Description: epitope description:QRCMCEALQQIMENQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  36. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500568

    Description: epitope description:CEALQQIMENQSDRL antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  37. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500572

    Description: epitope description:ALQQIMENQSDRLQG antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  38. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500583

    Description: epitope description:QSDRLQGRQQEQQFK antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  39. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500585

    Description: epitope description:QSDRLQGRQQEQQFK antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  40. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500596

    Description: epitope description:QQEQQFKRELRNLPQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  41. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500597

    Description: epitope description:QQEQQFKRELRNLPQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  42. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500599

    Description: epitope description:EQQFKRELRNLPQQC antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  43. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500608

    Description: epitope description:ELRNLPQQCGLRAPQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  44. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500609

    Description: epitope description:ELRNLPQQCGLRAPQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  45. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500612

    Description: epitope description:AEGCVGRVCDSRAMAVM host organism:Mus musculus BALB/c antibody name:5B170, 5B19

    Publication: 10814583;

  46. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500616

    Description: epitope description:RNLPQQCGLRAPQRC antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  47. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500618

    Description: epitope description:DRRCQSQLERANLRP antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  48. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500625

    Description: epitope description:MRLQVSPETLFWMECS host organism:Mus musculus BALB/c antibody name:7-10A

    Publication: 10814583;

  49. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500629

    Description: epitope description:SASRSCIGSQCSTTA host organism:Mus musculus C57BL/6

    Publication: 10814583;

  50. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500633

    Description: epitope description:GCIGSYCV host organism:Mus musculus C57BL/6

    Publication: 10814583;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston