Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Antibodies to a non-repeat region of Plasmodium falciparum antigen Pf155/RESA in individuals from malaria-endemic areas.

    ID: 1335490

    Description: epitope description:KEKLQKTYSQ antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 10361240;

  2. Antibodies to a non-repeat region of Plasmodium falciparum antigen Pf155/RESA in individuals from malaria-endemic areas.

    ID: 1335492

    Description: epitope description:EENVEENV antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 10361240;

  3. Antibodies to a non-repeat region of Plasmodium falciparum antigen Pf155/RESA in individuals from malaria-endemic areas.

    ID: 1335495

    Description: epitope description:INKRKYDSLKEKL antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 10361240;

  4. Identification of T and B cell epitopes recognized by humans in the C-terminal 42-kDa domain of the Plasmodium falciparum merozoite surface protein (M...

    ID: 1335517

    Description: epitope description:KQEGDKCVENPNPTCNENN antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 7538540;

  5. Identification of T and B cell epitopes recognized by humans in the C-terminal 42-kDa domain of the Plasmodium falciparum merozoite surface protein (M...

    ID: 1335527

    Description: epitope description:GCDADATCTEEDSGSSRKK antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 7538540;

  6. Identification of T and B cell epitopes recognized by humans in the C-terminal 42-kDa domain of the Plasmodium falciparum merozoite surface protein (M...

    ID: 1335532

    Description: epitope description:TCECTKPDSYPLFDGIFCS antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 7538540;

  7. Identification of T and B cell epitopes recognized by humans in the C-terminal 42-kDa domain of the Plasmodium falciparum merozoite surface protein (M...

    ID: 1335534

    Description: epitope description:PLFDGIFCSSSNFLGISFL antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 7538540;

  8. Isotypic analysis of Plasmodium falciparum-specific antibodies and their relation to protection in Madagascar.

    ID: 1335619

    Description: epitope description:DDEHVEEPTVA antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 7691751;

  9. Monoclonal antibodies that inhibit Plasmodium falciparum invasion in vitro recognise the first growth factor-like domain of merozoite surface protein-...

    ID: 1335653

    Description: epitope description:NISQHQCVKKQCPENSGCFRHLDEREECKCLLNYKQEGDKCVENPNPT antigen name:Merozoite surface protein 1 host organism:Mus musculus antibody name...

    Publication: 7694147;

  10. Pan DR binding sequence provides T-cell help for induction of protective antibodies against Plasmodium yoelii sporozoites.

    ID: 1335763

    Description: epitope description:QGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus

    Publication: 10195633;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston