Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472118

    Description: epitope description:LAHRNQSLDLAEQELVDCASQHGCH antigen name:Der p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 1940366;

  2. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472124

    Description: epitope description:AREQSCRRPNAQRFGISNYCQIYPPNANKIREALAQPQRYCRH antigen name:Der p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 1940366;

  3. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472130

    Description: epitope description:DLMMIEEYPYVVIL antigen name:Der p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 1940366;

  4. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472133

    Description: epitope description:LAHRNQSLDLAEQELVDCASQHGCH antigen name:Der p 1 host organism:Oryctolagus cuniculus antibody name:hyperimmune rabbit anti-Der p I s...

    Publication: 1940366;

  5. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472146

    Description: epitope description:EVCVRQLKAIANK antigen name:Triosephosphate isomerase host organism:Oryctolagus cuniculus antibody name:rabbit serum

    Publication: 10924792;

  6. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472147

    Description: epitope description:EVCVRQLKAIANK antigen name:Triosephosphate isomerase host organism:Oryctolagus cuniculus antibody name:rabbit serum

    Publication: 10924792;

  7. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472148

    Description: epitope description:KWFKTNAPNGVDEKIRI antigen name:Triosephosphate isomerase host organism:Mus musculus CBA antibody name:mouse serum

    Publication: 10924792;

  8. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472159

    Description: epitope description:SSFHCCGAKGPDDYRGNVPASCK antigen name:Tetraspanin host organism:Mus musculus CBA antibody name:mouse serum

    Publication: 10924792;

  9. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472165

    Description: epitope description:YFDGRGRAESIRMTLVAAGVDYEDERISFQDWPK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Oryctolagus cunicu...

    Publication: 10924792;

  10. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472166

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Mus musculus CBA antibody name:mous...

    Publication: 10924792;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston