Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Production of antibodies of predetermined specificity against herpes simplex virus DNA polymerase and their use in characterization of the enzyme.

    ID: 1377921

    Description: epitope description:MFSGGGGPLSPGGKS antigen name:DNA polymerase catalytic subunit host organism:Mus musculus BALB/c antibody name:mouse sera

    Publication: 2833607;

  2. Fine mapping of bovine herpesvirus-1 (BHV-1) glycoprotein D (gD) neutralizing epitopes by type-specific monoclonal antibodies and sequence comparison ...

    ID: 1377953

    Description: epitope description:LGAARGYTFGAC antigen name:envelope glycoprotein D host organism:Mus musculus BALB/c antibody name:MAb R54

    Publication: 7530392;

  3. Fine mapping of bovine herpesvirus-1 (BHV-1) glycoprotein D (gD) neutralizing epitopes by type-specific monoclonal antibodies and sequence comparison ...

    ID: 1377954

    Description: epitope description:LGAARGYTFGAC antigen name:envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7530392;

  4. Localization of epitopes of herpes simplex virus type 1 glycoprotein D.

    ID: 1377964

    Description: epitope description:HRRTRKAPKRIRLPHIR antigen name:Envelope glycoprotein D host organism:Mus musculus BALB/c antibody name:57S

    Publication: 2578577;

  5. Localization of epitopes of herpes simplex virus type 1 glycoprotein D.

    ID: 1377971

    Description: epitope description:HRRTRKAPKRIRLPHIR antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-34...

    Publication: 2578577;

  6. The nature of the immunogen determines the specificity of antibodies and T cells to selected peptides of the 38 kDa mycobacterial antigen.

    ID: 1377983

    Description: epitope description:MKIRLHTLLAVLTAAPLLLA antigen name:Phosphate-binding protein PstS 1 host organism:Mus musculus C57BL/10

    Publication: 7547682;

  7. Synthesis and comparison of antibody recognition of conjugates containing herpes simplex virus type 1 glycoprotein D epitope VII.

    ID: 1404124

    Description: epitope description:LKMADPNRFRG antigen name:Envelope glycoprotein D host organism:Mus musculus antibody name:A16

    Publication: 14624643;

  8. Monoclonal antibodies to recombinant Der p 2, a major house dust mite allergen: specificity, epitope analysis and development of two-site capture ELIS...

    ID: 1404280

    Description: epitope description:NQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWN antigen name:Der p 2 host organism:Mus musculus BALB/c antibody name:3B12, 2B6,...

    Publication: 10507224;

  9. Monoclonal antibodies to recombinant Der p 2, a major house dust mite allergen: specificity, epitope analysis and development of two-site capture ELIS...

    ID: 1404281

    Description: epitope description:NQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWN antigen name:Der p 2 host organism:Mus musculus BALB/c antibody name:3B12, 2B6,...

    Publication: 10507224;

  10. Recognition of human cytomegalovirus by human primary immunoglobulins identifies an innate foundation to an adaptive immune response.

    ID: 1404405

    Description: epitope description:ETIYNTTLKY antigen name:Envelope glycoprotein B host organism:Homo sapiens

    Publication: 15814702;

  11. A mimotope defined by phage display inhibits IgE binding to the plant panallergen profilin.

    ID: 1404636

    Description: epitope description:CAISGGYPVC host organism:Homo sapiens

    Publication: 9754579;

  12. Analysis of equine herpesvirus 2 strain variation using monoclonal antibodies to glyucoprotein B.

    ID: 1404639

    Description: epitope description:VAETTTPFATHRPEVVAEENPANPFLPFRVCGASPTGGEIFRFPLE antigen name:Envelope glycoprotein B (UniProt:Q66613) host organism:Mus musculus BA...

    Publication: 11003478;

  13. Analysis of equine herpesvirus 2 strain variation using monoclonal antibodies to glyucoprotein B.

    ID: 1404652

    Description: epitope description:VAETTTPFATHRPEVVAEENPANPFLPFRVCGASPTGGEIFRFPLE antigen name:Envelope glycoprotein B (UniProt:Q66613) host organism:Mus musculus BA...

    Publication: 11003478;

  14. The allergenic structure of allergen M from cod. I. Tryptic peptides of fragment TM 1.

    ID: 1404688

    Description: epitope description:EGSFDEDGFYAKVGLDAFSADELK antigen name:Gad m 1 host organism:Homo sapiens antibody name:patient serum

    Publication: 65337;

  15. The allergenic structure of allergen M from cod. I. Tryptic peptides of fragment TM 1.

    ID: 1404695

    Description: epitope description:EGFIEEDELKLFLIAFAADLR antigen name:Gad m 1 host organism:Homo sapiens antibody name:patient serum

    Publication: 65337;

  16. The allergenic structure of allergen M from cod. I. Tryptic peptides of fragment TM 1.

    ID: 1404698

    Description: epitope description:EGSFDEDGFYAKVGLDAFSADELKK antigen name:Gad m 1 host organism:Homo sapiens antibody name:patient serum

    Publication: 65337;

  17. Antibodies specific for the antigenic domain 1 of glycoprotein B (gpUL55) of human cytomegalovirus bind to different substructures.

    ID: 1404847

    Description: epitope description:C573, C610, P570, P577, P613 antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:7-5, 7-17, 9-3, ...

    Publication: 8614980;

  18. Purification and IgE-binding epitopes of a major allergen in the gastropod Turbo cornutus.

    ID: 1405150

    Description: epitope description:LAITEVDLERAEARLEAAEAK antigen name:Tropomyosin host organism:Homo sapiens

    Publication: 9720216;

  19. Enzyme-linked immunosorbent assay of a linear, recombinant peptide designed for immunotherapy of Japanese cedar pollinosis.

    ID: 1405195

    Description: epitope description:VDGIIAAYQNPASWK antigen name:Cry j 2 host organism:Mus musculus antibody name:E1.237, E1.156, E1.163, G1.67

    Publication: 16650781;

  20. Enzyme-linked immunosorbent assay of a linear, recombinant peptide designed for immunotherapy of Japanese cedar pollinosis.

    ID: 1405196

    Description: epitope description:LKMPMYIAGYKTFDG antigen name:Cry j 1 host organism:Mus musculus antibody name:G1.635, G1.432

    Publication: 16650781;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston