Purification and IgE-binding epitopes of a major allergen in the gastropod Turbo cornutus.

ID: 1405199

Description: epitope description:SLEISEQEASQREDSYEETIRDLTQRLK antigen name:Tropomyosin host organism:Homo sapiens

Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells.

ID: 1405238

Description: epitope description:QVSLESVDVYFQDVFGTMWC antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:...

Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells.

ID: 1405244

Description: epitope description:PSTSSKLRPRWTFTSPPVTT antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:...

Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells.

ID: 1405245

Description: epitope description:QVSLESVDVYFQDVFGTMWC antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:...

Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells.

ID: 1405251

Description: epitope description:PSTSSKLRPRWTFTSPPVTT antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408106

Description: epitope description:NPVYLIPET antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit anti...

Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis...

ID: 1408204

Description: epitope description:QQSPEQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis...

ID: 1408209

Description: epitope description:QQPPQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis...

ID: 1408210

Description: epitope description:QQFHQQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Humoral and cellular immune responses to synthetic peptides of the Leishmania donovani kinetoplastid membrane protein-11.

ID: 1408569

Description: epitope description:MATTYEEFSAKLDRLDEEFNRKMQEQNAKFFADKPDES antigen name:Kinetoplastid membrane protein-11 host organism:Homo sapiens antibody name:Hum...

Development of an equine herpesvirus type 4-specific enzyme-linked immunosorbent assay using a B-cell epitope as an antigen.

ID: 1408789

Description: epitope description:EGSLMLNVQHDD antigen name:70 host organism:Equus caballus

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408922

Description: epitope description:MEAALLVCQYTIQSL antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408931

Description: epitope description:YTIQSLIHLTGEDPG antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408940

Description: epitope description:GGKKHQLDLDFGQLT antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408943

Description: epitope description:KHQLDLDFGQLTPHT antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408945

Description: epitope description:KHQLDLDFGQLTPHT antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408947

Description: epitope description:LDLDFGQLTPHTKAV antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408948

Description: epitope description:LDLDFGQLTPHTKAV antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408955

Description: epitope description:PHTKAVYQPRGAFGG antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408961

Description: epitope description:YQPRGAFGGSENATN antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...