Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. ADAM-HCV, a new-concept diagnostic assay for antibodies to hepatitis C virus in serum.

    ID: 1329657

    Description: epitope description:DSLRYMYVMPGF host organism:Homo sapiens antibody name:C65/A18

    Publication: 11532012;

  2. Carbohydrate masking of an antigenic epitope of influenza virus haemagglutinin independent of oligosaccharide size.

    ID: 1329668

    Description: epitope description:LLSNTDNASFPQMTKSYKNT antigen name:Other Influenza A virus protein host organism:Oryctolagus cuniculus

    Publication: 1379858;

  3. Carbohydrate masking of an antigenic epitope of influenza virus haemagglutinin independent of oligosaccharide size.

    ID: 1329670

    Description: epitope description:LLSNTDNASFPQMTKSYKNT antigen name:Other Influenza A virus protein host organism:Oryctolagus cuniculus

    Publication: 1379858;

  4. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329674

    Description: epitope description:DRHFLN antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  5. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329678

    Description: epitope description:GVTTSLS antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  6. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329693

    Description: epitope description:MLQVTDVSL antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  7. ADAM-HCV, a new-concept diagnostic assay for antibodies to hepatitis C virus in serum.

    ID: 1329698

    Description: epitope description:YSREQLNKLFGIEVM host organism:Homo sapiens antibody name:HCV-positive sera

    Publication: 11532012;

  8. ADAM-HCV, a new-concept diagnostic assay for antibodies to hepatitis C virus in serum.

    ID: 1329703

    Description: epitope description:MLRTWLMKTQGIESW host organism:Homo sapiens antibody name:HCV-positive sera

    Publication: 11532012;

  9. ADAM-HCV, a new-concept diagnostic assay for antibodies to hepatitis C virus in serum.

    ID: 1329709

    Description: epitope description:MSRTWLMKAHGIESW host organism:Homo sapiens antibody name:HCV-positive sera

    Publication: 11532012;

  10. Chimeric monoclonal antibodies to hypervariable region 1 of hepatitis C virus.

    ID: 1329731

    Description: epitope description:KGLNGLFDLGPKQKI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:cAb 2P24

    Publication: 15914849;

  11. Chimeric monoclonal antibodies to hypervariable region 1 of hepatitis C virus.

    ID: 1329745

    Description: epitope description:RTLTGMFSLGARQKI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:cAb 2P24

    Publication: 15914849;

  12. Chimeric monoclonal antibodies to hypervariable region 1 of hepatitis C virus.

    ID: 1329749

    Description: epitope description:KGLNGLFDLGPKQKI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mAb 15H4, human (constant region )...

    Publication: 15914849;

  13. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334518

    Description: epitope description:ASHLPYIEQGMQLAAEFKQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  14. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334524

    Description: epitope description:GRIILSGKPATIPDREVLYR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  15. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334526

    Description: epitope description:PATIPDREVLYREFDEMEEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  16. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334550

    Description: epitope description:GRIILSGRPAVIPDREVLYR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  17. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334563

    Description: epitope description:GRIILSGRPAIIPDREVLYR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  18. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334571

    Description: epitope description:PYIEQGMQLAEQFKQKARGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  19. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334584

    Description: epitope description:PYIEQGMQLAEQFKQKALGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  20. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334599

    Description: epitope description:LAEQLKQKALGLLQTATKQA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  21. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334606

    Description: epitope description:ALYREFDEMEECASHLPYIE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  22. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334627

    Description: epitope description:ALGLLQTATKQAEAAAPMV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  23. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334677

    Description: epitope description:LAEQFKQKALGLLQTASRHA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  24. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334697

    Description: epitope description:VLYQEFDEMEECSQHLPYIE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  25. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334728

    Description: epitope description:QGMMLAEQFKQKALGLLQTA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  26. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334743

    Description: epitope description:FKQKALGLLQTASIQAEAIA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  27. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334744

    Description: epitope description:ALGLLQTASIQAEAIAPAV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  28. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334795

    Description: epitope description:FKQKALGLLQTASRQAEVIQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  29. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334812

    Description: epitope description:PAIIPDREVLYREFDEMEEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  30. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334824

    Description: epitope description:LSGKPAIIPDREALYQQFDE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  31. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334827

    Description: epitope description:ALYQQFDEMEECSASLPYMD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  32. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334828

    Description: epitope description:QFDEMEECSASLPYMDETRA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  33. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334830

    Description: epitope description:SASLPYMDETRAIAGQFKEK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  34. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334831

    Description: epitope description:PYMDETRAIAGQFKEKVLGF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  35. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334841

    Description: epitope description:QYDEMEECSKARPYIEQAQV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  36. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334861

    Description: epitope description:ILGLLQRATQQQAVIEPVI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  37. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334876

    Description: epitope description:LGGKPALVPDKEVLYQQYDE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  38. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334881

    Description: epitope description:MEECSQAAPYIEQAQAIAHQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  39. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334885

    Description: epitope description:IAHQFKEKVLGLLQRATQQQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  40. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334886

    Description: epitope description:FKEKVLGLLQRATQQQAVIE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  41. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334915

    Description: epitope description:LGGKPALVPDRQVLYQQYDE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  42. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334931

    Description: epitope description:VLYQQYDEMEECSQAGPYIE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  43. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334940

    Description: epitope description:GRLHLNDRVVVAPDKEILYE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  44. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334959

    Description: epitope description:MEECASKAALIEEGQRMAEM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  45. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334961

    Description: epitope description:ALIEEGQRMAEMLKSKIQGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  46. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334965

    Description: epitope description:IQGLLQQATRQAQDIQPVV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  47. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334969

    Description: epitope description:PDKEVLYEAFDEMEECASRA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  48. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334971

    Description: epitope description:AFDEMEECASRAALIEEGQR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  49. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1334998

    Description: epitope description:EMEECASKAALIEEGQRMAE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  50. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335013

    Description: epitope description:TLIEEGQRIAEMLKSKIQGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  51. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335018

    Description: epitope description:GRLHINQRTVVAPDKEVLYE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  52. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335026

    Description: epitope description:ALLEEGQRIAEMLKSKIQGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  53. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335031

    Description: epitope description:GRVVLSGQPAVIPDREVLYQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  54. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335033

    Description: epitope description:PAVIPDREVLYQQFDEMEEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  55. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335034

    Description: epitope description:PDREVLYQQFDEMEECSKHL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  56. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335045

    Description: epitope description:LTGKPAVVPDREILYQQFDE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  57. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335046

    Description: epitope description:PAVVPDREILYQQFDEMEEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  58. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335051

    Description: epitope description:SRHIPYLAEGQQIAEQFRQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  59. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335052

    Description: epitope description:PYLAEGQQIAEQFRQKVLGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  60. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335056

    Description: epitope description:VLGLLQASAKQAEELKPAV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  61. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335061

    Description: epitope description:NRLIAFASRGNHDSPTHYV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  62. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335063

    Description: epitope description:SRGNHDSPTHYVPESDAAAR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  63. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335077

    Description: epitope description:PESEPAARVTQILSSLTITQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  64. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335078

    Description: epitope description:PAARVTQILSSLTITQLLKR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  65. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335084

    Description: epitope description:AFAFAGNHVSPTHYVPESDA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  66. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335089

    Description: epitope description:AAARVTQILSSLTITQLLKR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  67. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335091

    Description: epitope description:HVGPGEGAVQWMNRLIAFAS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  68. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335094

    Description: epitope description:NRLIAFASRGNHVAPTHYVT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  69. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335095

    Description: epitope description:AFASRGNHVAPTHYVTESD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  70. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335099

    Description: epitope description:TESDASQRVTQLLGSLTITS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  71. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335103

    Description: epitope description:GEGAVQWMNRLIAFASRGNH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  72. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335110

    Description: epitope description:VESDASQRVTQVLSSLTITS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  73. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335111

    Description: epitope description:ASQRVTQVLSSLTITSLLRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  74. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335117

    Description: epitope description:AFASRGNHVSPTHYVPESDA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  75. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335129

    Description: epitope description:SRGNHVSPAHYVPESDAAAR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  76. Cellular and antibody responses to the Plasmodium falciparum heat shock protein Pf72/HSP70 during and after acute malaria in individuals from an endem...

    ID: 1335171

    Description: epitope description:SKIYQDAAGAAGGMPG antigen name:Heat shock 70 kDa protein host organism:Homo sapiens

    Publication: 10379811;

  77. Comparison of analytical methods for the evaluation of antibody responses against epitopes of polymorphic protein antigens.

    ID: 1335188

    Description: epitope description:YGLFQKEKMVL antigen name:Merozoite surface protein 1 host organism:Mus musculus C57BL/6 human IgCkappa Tg antibody name:7.19

    Publication: 12738356;

  78. Comparison of analytical methods for the evaluation of antibody responses against epitopes of polymorphic protein antigens.

    ID: 1335192

    Description: epitope description:YGLFHKEKMIL antigen name:Merozoite surface protein 1 host organism:Mus musculus C57BL/6 human IgCkappa Tg antibody name:7.27

    Publication: 12738356;

  79. MSP-1 malaria pseudopeptide analogs: biological and immunological significance and three-dimensional structure.

    ID: 1335214

    Description: epitope description:EVLYLKPLAGVYRSLKKQLE + MCM(K6, P7) antigen name:Merozoite surface protein 1 host organism:Mus musculus BALB/c antibody name:Mouse ...

    Publication: 12674501;

  80. Stable expression and secretion of the B-cell epitope of rodent malaria from Mycobacterium bovis BCG and induction of long-lasting humoral response in...

    ID: 1335230

    Description: epitope description:PQGPGAPQGPGAPQGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Oryctolagus cuniculus

    Publication: 8821650;

  81. Comparison of analytical methods for the evaluation of antibody responses against epitopes of polymorphic protein antigens.

    ID: 1335276

    Description: epitope description:YGLFHKEKMIL antigen name:Merozoite surface protein 1 host organism:Mus musculus C57BL/6 human IgCkappa Tg antibody name:7.19

    Publication: 12738356;

  82. Comparison of analytical methods for the evaluation of antibody responses against epitopes of polymorphic protein antigens.

    ID: 1335277

    Description: epitope description:YGLFHKEKMLL antigen name:Merozoite surface protein 1 host organism:Mus musculus C57BL/6 human IgCkappa Tg antibody name:7.27

    Publication: 12738356;

  83. Comparison of analytical methods for the evaluation of antibody responses against epitopes of polymorphic protein antigens.

    ID: 1335278

    Description: epitope description:YGLFHKEKMLL antigen name:Merozoite surface protein 1 host organism:Mus musculus C57BL/6 human IgCkappa Tg antibody name:7.19

    Publication: 12738356;

  84. A conserved peptide sequence of the Plasmodium falciparum circumsporozoite protein and antipeptide antibodies inhibit Plasmodium berghei sporozoite in...

    ID: 1335350

    Description: epitope description:IEQYLKKIKNSISTEWSPCSVTCGNGIQVRIK antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

    Publication: 7591073;

  85. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328280

    Description: epitope description:LPLRGKLSFWEAGTTKAGYPYNYNT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  86. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328282

    Description: epitope description:LAPHSALALLEDTMDYPARAHTFDD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  87. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328285

    Description: epitope description:CPECRPLGLQGCAFQSTVAELQRLK antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  88. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328298

    Description: epitope description:DSRGAILRRQYNLSTSPLTSSVATG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  89. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328299

    Description: epitope description:RQYNLSTSPLTSSVATGTNLVLYAA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  90. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328302

    Description: epitope description:VPNAVGGYAISISFWPQTTTTPTSV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  91. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328303

    Description: epitope description:SISFWPQTTTTPTSVDMNSITSTDV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  92. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328309

    Description: epitope description:RHRLRRGADGTAELTTTAATRFMKD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  93. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328311

    Description: epitope description:PTVKLYTSVENAQQDKGIAIPHDID antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  94. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328315

    Description: epitope description:SRVVIQDYDNQHEQDRPTPSPAPSR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  95. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328317

    Description: epitope description:GPVYVSDSVTLVNVATGAQAVARSL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  96. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328320

    Description: epitope description:TTKAGYPYNYNTTASDQLLVENAAG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  97. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328323

    Description: epitope description:HTFDDFCPECRPLGLQGCAFQSTVA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  98. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328328

    Description: epitope description:GSGGGFWGDRVDSQPFAI antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  99. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328338

    Description: epitope description:YSRPVVSANGEPTVKLYT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  100. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328368

    Description: epitope description:VLPLRGKLSFWEAGTTKAGYPYNYNTTASD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston