Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328303

    Description: epitope description:SISFWPQTTTTPTSVDMNSITSTDV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  2. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328309

    Description: epitope description:RHRLRRGADGTAELTTTAATRFMKD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  3. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328311

    Description: epitope description:PTVKLYTSVENAQQDKGIAIPHDID antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  4. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328315

    Description: epitope description:SRVVIQDYDNQHEQDRPTPSPAPSR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  5. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328317

    Description: epitope description:GPVYVSDSVTLVNVATGAQAVARSL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  6. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328320

    Description: epitope description:TTKAGYPYNYNTTASDQLLVENAAG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  7. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328323

    Description: epitope description:HTFDDFCPECRPLGLQGCAFQSTVA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  8. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328328

    Description: epitope description:GSGGGFWGDRVDSQPFAI antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  9. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328338

    Description: epitope description:YSRPVVSANGEPTVKLYT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  10. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328368

    Description: epitope description:VLPLRGKLSFWEAGTTKAGYPYNYNTTASD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston