Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "
  1. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328473

    Description: epitope description:RYSSTARHRLRRGADGTAELTTTAA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;
  2. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328481

    Description: epitope description:PFSVLRANDVLWLSLTAAEYDQSTY antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;
  3. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328485

    Description: epitope description:LDGRPLSTIQQYSKTFFVLPLRGKL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;
  4. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328486

    Description: epitope description:SKTFFVLPLRGKLSFWEAGTTKAGY antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;
  5. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328503

    Description: epitope description:PNAVGGYAISISFWPQTTTTPTSVDMNSIT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;
  6. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328509

    Description: epitope description:LYFTSTNGVGEIGRGIALTLFNLADTLLGG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;
  7. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328516

    Description: epitope description:LDGRPLSTIQQYSKTFFVLPLRGKLSFWEA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;
  8. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329034

    Description: epitope description:DVSLRFGDR antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;
  9. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329040

    Description: epitope description:GDRKLFEDV antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;
  10. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329043

    Description: epitope description:KLFEDVNIK antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

Displaying 10 of 1,510,353 results for " "