Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340665

    Description: epitope description:GGQSESVEFTKDTQT antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  2. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340666

    Description: epitope description:SESVEFTKDTQTGMS antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  3. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340668

    Description: epitope description:TKDTQTGMSGQTTPQ antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  4. Potent immunogenic short linear peptide constructs composed of B cell epitopes and Pan DR T helper epitopes (PADRE) for antibody responses in vivo.

    ID: 1340710

    Description: epitope description:NANPNANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

    Publication: 9141216;

  5. Antigenicity of recombinant proteins derived from Plasmodium falciparum merozoite surface protein 1.

    ID: 1340717

    Description: epitope description:THESYQELVKKLEALEDAVLTGYGLFHKEKMIL antigen name:Merozoite surface protein 1 host organism:Mus musculus CBA/Ca antibody name:Mouse s...

    Publication: 9106193;

  6. Synthesis of a diepitope multiple antigen peptide containing sequences from two malaria antigens using Fmoc chemistry.

    ID: 1340719

    Description: epitope description:VTEEIVTEEIVTEEI host organism:Mus musculus C57BL/10 X DBA/2 antibody name:B10.D2

    Publication: 7533196;

  7. Structural and antigenic properties of merozoite surface protein 4 of Plasmodium falciparum.

    ID: 1340729

    Description: epitope description:DLCKHNNGDCGDDKLCEYVGNRRVKCKCKEGYKLEGIECVELLSL antigen name:Merozoite surface protein 4 host organism:Oryctolagus cuniculus New Zea...

    Publication: 10225874;

  8. Fine specificity of immune responses to epitopic sequences in synthetic peptides containing B and T epitopes from the conserved Plasmodium falciparum ...

    ID: 1340731

    Description: epitope description:LDNIKGNVGKNEDYIKKNKK antigen name:Merozoite surface protein 1 host organism:Mus musculus BALB/c

    Publication: 8578829;

  9. Fine specificity of immune responses to epitopic sequences in synthetic peptides containing B and T epitopes from the conserved Plasmodium falciparum ...

    ID: 1340739

    Description: epitope description:EENVEHDAEENVEENV antigen name:DNAJ protein, putative host organism:Mus musculus BALB/c

    Publication: 8578829;

  10. Influence of adjuvants in inducing immune responses to different epitopes included in a multiepitope, multivalent, multistage Plasmodium falciparum ca...

    ID: 1340747

    Description: epitope description:NSGCFRHLDEREECKCLL antigen name:Merozoite surface protein 1 host organism:Mus musculus ICR

    Publication: 12243733;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston