Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328378

    Description: epitope description:LHYRNQGWRSVETSGVAEEEATSGL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  2. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328384

    Description: epitope description:RHRLRRGADGTAELTTTAATRFMKD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  3. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328387

    Description: epitope description:GLPTELISSAGGQLFYSRPVVSANG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  4. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328388

    Description: epitope description:IPHDIDLGESRVVIQDYDNQHEQDR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  5. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328393

    Description: epitope description:TLVNVATGAQAVARSLDWTKVTLDG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  6. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328407

    Description: epitope description:PDVTAAAGAGPRVRQPAR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  7. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328408

    Description: epitope description:VRQPARPLGSAWRDQAQR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  8. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328410

    Description: epitope description:PAHDTPPVPDVDSRGAIL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  9. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328411

    Description: epitope description:SRGAILRRQYNLSTSPLT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  10. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328413

    Description: epitope description:SPLTSSVATGTNLVLYAA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  11. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328420

    Description: epitope description:AISISFWPQTTTTPTSVD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  12. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328430

    Description: epitope description:LLDFALELEFRNLTPGNT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  13. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328432

    Description: epitope description:FRNLTPGNTNTRVSRYSS antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  14. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328435

    Description: epitope description:HRLRRGADGTAELTTTAA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  15. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328437

    Description: epitope description:TAATRFMKDLYFTSTNGV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  16. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328438

    Description: epitope description:NGVGEIGRGIALTLFNLA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  17. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328443

    Description: epitope description:EQDRPTPSPAPSRPFSVL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  18. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328446

    Description: epitope description:RANDVLWLSLTAAEYDQS antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  19. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328466

    Description: epitope description:APLSPLLPLQDGTNTHIMATEASNY antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  20. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328468

    Description: epitope description:TDVRILVQPGIASELVIPSERLHYR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  21. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328473

    Description: epitope description:RYSSTARHRLRRGADGTAELTTTAA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  22. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328481

    Description: epitope description:PFSVLRANDVLWLSLTAAEYDQSTY antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  23. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328485

    Description: epitope description:LDGRPLSTIQQYSKTFFVLPLRGKL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  24. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328486

    Description: epitope description:SKTFFVLPLRGKLSFWEAGTTKAGY antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  25. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328503

    Description: epitope description:PNAVGGYAISISFWPQTTTTPTSVDMNSIT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  26. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328509

    Description: epitope description:LYFTSTNGVGEIGRGIALTLFNLADTLLGG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  27. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328516

    Description: epitope description:LDGRPLSTIQQYSKTFFVLPLRGKLSFWEA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  28. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329034

    Description: epitope description:DVSLRFGDR antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  29. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329040

    Description: epitope description:GDRKLFEDV antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  30. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329043

    Description: epitope description:KLFEDVNIK antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  31. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329051

    Description: epitope description:KFTEGNCYG antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  32. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329053

    Description: epitope description:TEGNCYGLI antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  33. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329055

    Description: epitope description:GNCYGLIGA antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  34. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329065

    Description: epitope description:GAGKSTFLK antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  35. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329074

    Description: epitope description:ILSGELDSQ antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  36. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329085

    Description: epitope description:HVSLGKNER antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  37. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329091

    Description: epitope description:NERLAVLKQ antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  38. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329099

    Description: epitope description:QDHYAYEDE antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  39. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329100

    Description: epitope description:DHYAYEDER antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  40. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329107

    Description: epitope description:ERVLDVVIK antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  41. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329111

    Description: epitope description:DVVIKGHER antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  42. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329129

    Description: epitope description:EIYMKPDFS antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  43. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329130

    Description: epitope description:IYMKPDFSD antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  44. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329138

    Description: epitope description:DEDGIRAAE antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  45. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329143

    Description: epitope description:RAAELEGEF antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  46. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329167

    Description: epitope description:LSGLGIDPT antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  47. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329172

    Description: epitope description:IDPTLHDKK antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  48. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340549

    Description: epitope description:VETEDTKEPGVLMGGQ antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  49. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340550

    Description: epitope description:DTKEPGVLMGGQSESV antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  50. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340557

    Description: epitope description:QTTPQVETEDTKEPGV antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  51. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340620

    Description: epitope description:MGGQSESVEFTKDTQT antigen name:UniProt:A2RC81 host organism:Mus musculus BALB/c

    Publication: 14638816;

  52. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340621

    Description: epitope description:SESVEFTKDTQTGMSG antigen name:UniProt:A2RC81 host organism:Mus musculus BALB/c

    Publication: 14638816;

  53. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340622

    Description: epitope description:EFTKDTQTGMAGQTTP antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus BALB/c

    Publication: 14638816;

  54. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340625

    Description: epitope description:QTTPQVETEDTKEPGV antigen name:UniProt:A2RC81 host organism:Mus musculus BALB/c

    Publication: 14638816;

  55. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340626

    Description: epitope description:QVETEDTKEPGVLMGG antigen name:UniProt:A2RC81 host organism:Mus musculus BALB/c

    Publication: 14638816;

  56. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340638

    Description: epitope description:KEPGVLMGGQSESVE antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  57. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340639

    Description: epitope description:GVLMGGQSESVEFTK antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  58. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340646

    Description: epitope description:SGQTTPQVETEDTKE antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  59. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340652

    Description: epitope description:LMGGQSESVEFTKDT antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  60. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340660

    Description: epitope description:SQVETEDTKEPGVLM antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  61. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340665

    Description: epitope description:GGQSESVEFTKDTQT antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  62. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340666

    Description: epitope description:SESVEFTKDTQTGMS antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  63. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340668

    Description: epitope description:TKDTQTGMSGQTTPQ antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  64. Potent immunogenic short linear peptide constructs composed of B cell epitopes and Pan DR T helper epitopes (PADRE) for antibody responses in vivo.

    ID: 1340710

    Description: epitope description:NANPNANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

    Publication: 9141216;

  65. Antigenicity of recombinant proteins derived from Plasmodium falciparum merozoite surface protein 1.

    ID: 1340717

    Description: epitope description:THESYQELVKKLEALEDAVLTGYGLFHKEKMIL antigen name:Merozoite surface protein 1 host organism:Mus musculus CBA/Ca antibody name:Mouse s...

    Publication: 9106193;

  66. Synthesis of a diepitope multiple antigen peptide containing sequences from two malaria antigens using Fmoc chemistry.

    ID: 1340719

    Description: epitope description:VTEEIVTEEIVTEEI host organism:Mus musculus C57BL/10 X DBA/2 antibody name:B10.D2

    Publication: 7533196;

  67. Structural and antigenic properties of merozoite surface protein 4 of Plasmodium falciparum.

    ID: 1340729

    Description: epitope description:DLCKHNNGDCGDDKLCEYVGNRRVKCKCKEGYKLEGIECVELLSL antigen name:Merozoite surface protein 4 host organism:Oryctolagus cuniculus New Zea...

    Publication: 10225874;

  68. Fine specificity of immune responses to epitopic sequences in synthetic peptides containing B and T epitopes from the conserved Plasmodium falciparum ...

    ID: 1340731

    Description: epitope description:LDNIKGNVGKNEDYIKKNKK antigen name:Merozoite surface protein 1 host organism:Mus musculus BALB/c

    Publication: 8578829;

  69. Fine specificity of immune responses to epitopic sequences in synthetic peptides containing B and T epitopes from the conserved Plasmodium falciparum ...

    ID: 1340739

    Description: epitope description:EENVEHDAEENVEENV antigen name:DNAJ protein, putative host organism:Mus musculus BALB/c

    Publication: 8578829;

  70. Influence of adjuvants in inducing immune responses to different epitopes included in a multiepitope, multivalent, multistage Plasmodium falciparum ca...

    ID: 1340747

    Description: epitope description:NSGCFRHLDEREECKCLL antigen name:Merozoite surface protein 1 host organism:Mus musculus ICR

    Publication: 12243733;

  71. Influence of adjuvants in inducing immune responses to different epitopes included in a multiepitope, multivalent, multistage Plasmodium falciparum ca...

    ID: 1340748

    Description: epitope description:EDSGSNGKKITCECTKPDS antigen name:Merozoite surface protein 1 host organism:Mus musculus ICR

    Publication: 12243733;

  72. Influence of adjuvants in inducing immune responses to different epitopes included in a multiepitope, multivalent, multistage Plasmodium falciparum ca...

    ID: 1340751

    Description: epitope description:DGNCEDIPHVNEFSAIDL antigen name:Apical membrane antigen 1 host organism:Mus musculus ICR

    Publication: 12243733;

  73. Influence of adjuvants in inducing immune responses to different epitopes included in a multiepitope, multivalent, multistage Plasmodium falciparum ca...

    ID: 1340755

    Description: epitope description:QYIKANSKFIGITEL antigen name:Tetanus toxin host organism:Mus musculus ICR

    Publication: 12243733;

  74. Influence of adjuvants in inducing immune responses to different epitopes included in a multiepitope, multivalent, multistage Plasmodium falciparum ca...

    ID: 1340764

    Description: epitope description:GISYYEKVLAKYKDDLE antigen name:Merozoite surface protein 1 host organism:Mus musculus ICR

    Publication: 12243733;

  75. Immunogenicity of four Plasmodium falciparum preerythrocytic antigens in Aotus lemurinus monkeys.

    ID: 1340775

    Description: epitope description:DELFNELLNSVDVNGEVKENILEESQ antigen name:Liver stage antigen 3 host organism:Aotus lemurinus

    Publication: 9632616;

  76. Immunogenicity of four Plasmodium falciparum preerythrocytic antigens in Aotus lemurinus monkeys.

    ID: 1340816

    Description: epitope description:SAEKKDEKEASEQGEESHKKENSQESA antigen name:Merozoite surface protein 4 host organism:Aotus lemurinus

    Publication: 9632616;

  77. Human antibodies to the 19kDa C-terminal fragment of Plasmodium falciparum merozoite surface protein 1 inhibit parasite growth in vitro.

    ID: 1340863

    Description: epitope description:NPNPTCNENNGGCDADATCTEEDSGSSRKKITCECTKPDSYPLFDGIFCSSSN antigen name:Merozoite surface protein 1 host organism:Homo sapiens antibody...

    Publication: 10205793;

  78. Co-dominant and reciprocal T-helper cell activity of epitopic sequences and formation of junctional B-cell determinants in synthetic T:B chimeric immu...

    ID: 1340864

    Description: epitope description:QYIKANSKFIGITEL antigen name:Tetanus toxin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8296485;

  79. Co-dominant and reciprocal T-helper cell activity of epitopic sequences and formation of junctional B-cell determinants in synthetic T:B chimeric immu...

    ID: 1340865

    Description: epitope description:DIEKKIAKMEKASSVFNVVNS host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8296485;

  80. A multiple antigen peptide from the repetitive sequence of the Plasmodium malariae circumsporozoite protein induces a specific antibody response in mi...

    ID: 1340916

    Description: epitope description:NAAGNAAGNAAGNAAGNAAGNAAG antigen name:Circumsporozoite protein host organism:Mus musculus C3H/He

    Publication: 2201549;

  81. Induction of protective polyclonal antibodies by immunization with a Plasmodium yoelii circumsporozoite protein multiple antigen peptide vaccine.

    ID: 1340927

    Description: epitope description:QGPGAPQGPGAPQGPGAPQGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus

    Publication: 7876549;

  82. Induction of protective polyclonal antibodies by immunization with a Plasmodium yoelii circumsporozoite protein multiple antigen peptide vaccine.

    ID: 1340935

    Description: epitope description:QGPGAPQGPGAPQGPGAPQGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus

    Publication: 7876549;

  83. Immunogenicity of multiple antigen peptides containing B and non-repeat T cell epitopes of the circumsporozoite protein of Plasmodium falciparum.

    ID: 1340936

    Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus

    Publication: 7679427;

  84. Immunogenicity of Plasmodium falciparum and Plasmodium vivax circumsporozoite protein repeat multiple antigen constructs (MAC).

    ID: 1340954

    Description: epitope description:ANGAGNQPGANGAGNQPG antigen name:Circumsporozoite protein, putative host organism:Mus musculus B10.A

    Publication: 9682348;

  85. Plasmodium falciparum polyoximes: highly immunogenic synthetic vaccines constructed by chemoselective ligation of repeat B-cell epitopes and a univers...

    ID: 1340957

    Description: epitope description:DPNANPNVDPNANPNVNANPNANPNANP host organism:Mus musculus C57BL/10 antibody name:Mouse sera

    Publication: 9569470;

  86. Plasmodium falciparum polyoximes: highly immunogenic synthetic vaccines constructed by chemoselective ligation of repeat B-cell epitopes and a univers...

    ID: 1340968

    Description: epitope description:DPNANPNVDPNANPNVNANPNANPNANP host organism:Mus musculus A/J antibody name:Mouse sera

    Publication: 9569470;

  87. Immunogenicity of Plasmodium falciparum and Plasmodium vivax circumsporozoite protein repeat multiple antigen constructs (MAC).

    ID: 1340971

    Description: epitope description:NANPNANPNANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/10 X DBA/2

    Publication: 9682348;

  88. Effect of context and adjuvant on the immunogenicity of recombinant proteins and peptide conjugates derived from the polymorphic malarial surface anti...

    ID: 1340976

    Description: epitope description:QHGHMHGS antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus Quackenbush

    Publication: 8821653;

  89. Plasmodium falciparum polyoximes: highly immunogenic synthetic vaccines constructed by chemoselective ligation of repeat B-cell epitopes and a univers...

    ID: 1341005

    Description: epitope description:DPNANPNVDPNANPNVNANPNANPNANP host organism:Mus musculus C57BL/10 antibody name:Mouse sera

    Publication: 9569470;

  90. Plasmodium falciparum polyoximes: highly immunogenic synthetic vaccines constructed by chemoselective ligation of repeat B-cell epitopes and a univers...

    ID: 1341009

    Description: epitope description:DPNANPNVDPNANPNVNANPNANPNANP host organism:Mus musculus A/J antibody name:Mouse sera

    Publication: 9569470;

  91. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341063

    Description: epitope description:NPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;

  92. Induction of neonatal tolerance by plasmid DNA vaccination of mice.

    ID: 1341089

    Description: epitope description:VVADENVDQGPGAPQGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus BALB/c antibody name:Mouse ...

    Publication: 8981914;

  93. Induction of neonatal tolerance by plasmid DNA vaccination of mice.

    ID: 1341090

    Description: epitope description:VVADENVDQGPGAPQGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus BALB/c antibody name:Mouse ...

    Publication: 8981914;

  94. Induction of neonatal tolerance by plasmid DNA vaccination of mice.

    ID: 1341096

    Description: epitope description:EEWSQCSVYCGSGVRVRKRK antigen name:Circumsporozoite protein (UniProt:P06914) host organism:Mus musculus BALB/c antibody name:Mouse ...

    Publication: 8981914;

  95. Induction of neonatal tolerance by plasmid DNA vaccination of mice.

    ID: 1341098

    Description: epitope description:GSGVRVRKRKNVNKQPENLT antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus BALB/c antibody name:Mouse ...

    Publication: 8981914;

  96. Induction of neonatal tolerance by plasmid DNA vaccination of mice.

    ID: 1341100

    Description: epitope description:MDKCSSIFNIVSNSLGFVIL antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus BALB/c antibody name:Mouse ...

    Publication: 8981914;

  97. Active and passive immunization against Plasmodium yoelii sporozoites.

    ID: 1341112

    Description: epitope description:QGPGAPQGPGAPQGPGAPQGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus BALB/cByJ antibody name...

    Publication: 1709834;

  98. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341115

    Description: epitope description:PNDPPP antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;

  99. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341125

    Description: epitope description:NPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;

  100. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341128

    Description: epitope description:NPNVDP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston