Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "
  1. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341138

    Description: epitope description:PNDPPP antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;
  2. Plasmodium falciparum AARP1, a giant protein containing repeated motifs rich in asparagine and aspartate residues, is associated with the infected ery...

    ID: 1341144

    Description: epitope description:YNNDDDNDDDNDDNNDDNN antigen name:Asparagine/aspartate rich protein, putative host organism:Homo sapiens

    Publication: 9234746;
  3. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341148

    Description: epitope description:ANDPPP antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;
  4. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341154

    Description: epitope description:PNANPN antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;
  5. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341169

    Description: epitope description:NANDPP antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;
  6. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341182

    Description: epitope description:NPNDPP antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;
  7. Plasmodium falciparum: an epitope within a highly conserved region of the 47-kDa amino-terminal domain of the serine repeat antigen is a target of par...

    ID: 1341185

    Description: epitope description:KNVIKCTGESQTGNTGGGQAGNTVGDQAGSTGGSPQGSTGAS antigen name:Serine-repeat antigen protein host organism:Capra hircus antibody name:PIP...

    Publication: 9030663;
  8. Plasmodium falciparum: an epitope within a highly conserved region of the 47-kDa amino-terminal domain of the serine repeat antigen is a target of par...

    ID: 1341187

    Description: epitope description:HSVSTVSVSQTSTSSEKQDTIQVKSALLKDYMGLKVTG antigen name:Serine-repeat antigen protein host organism:Homo sapiens

    Publication: 9030663;
  9. Cross-reactive antigenic determinants present on different Plasmodium falciparum blood-stage antigens.

    ID: 1341344

    Description: epitope description:EENVEENVEENVEENV antigen name:DNAJ protein, putative host organism:Homo sapiens antibody name:33G2

    Publication: 2467248;
  10. A study of antibody and T cell recognition of rhoptry-associated protein-1 (RAP-1) and RAP-2 recombinant proteins and peptides of Plasmodium falciparu...

    ID: 1341347

    Description: epitope description:YSRQYSNRAAENFKAIRE antigen name:Rhoptry-associated protein 2, RAP2 host organism:Homo sapiens

    Publication: 9715934;

Displaying 10 of 1,510,353 results for " "