Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341138

    Description: epitope description:PNDPPP antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;

  2. Plasmodium falciparum AARP1, a giant protein containing repeated motifs rich in asparagine and aspartate residues, is associated with the infected ery...

    ID: 1341144

    Description: epitope description:YNNDDDNDDDNDDNNDDNN antigen name:Asparagine/aspartate rich protein, putative host organism:Homo sapiens

    Publication: 9234746;

  3. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341148

    Description: epitope description:ANDPPP antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;

  4. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341154

    Description: epitope description:PNANPN antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;

  5. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341169

    Description: epitope description:NANDPP antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;

  6. A protective monoclonal antibody with dual specificity for Plasmodium falciparum and Plasmodium berghei circumsporozoite proteins.

    ID: 1341182

    Description: epitope description:NPNDPP antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus BALB/c antibody name:Mab 36

    Publication: 1375561;

  7. Plasmodium falciparum: an epitope within a highly conserved region of the 47-kDa amino-terminal domain of the serine repeat antigen is a target of par...

    ID: 1341185

    Description: epitope description:KNVIKCTGESQTGNTGGGQAGNTVGDQAGSTGGSPQGSTGAS antigen name:Serine-repeat antigen protein host organism:Capra hircus antibody name:PIP...

    Publication: 9030663;

  8. Plasmodium falciparum: an epitope within a highly conserved region of the 47-kDa amino-terminal domain of the serine repeat antigen is a target of par...

    ID: 1341187

    Description: epitope description:HSVSTVSVSQTSTSSEKQDTIQVKSALLKDYMGLKVTG antigen name:Serine-repeat antigen protein host organism:Homo sapiens

    Publication: 9030663;

  9. Cross-reactive antigenic determinants present on different Plasmodium falciparum blood-stage antigens.

    ID: 1341344

    Description: epitope description:EENVEENVEENVEENV antigen name:DNAJ protein, putative host organism:Homo sapiens antibody name:33G2

    Publication: 2467248;

  10. A study of antibody and T cell recognition of rhoptry-associated protein-1 (RAP-1) and RAP-2 recombinant proteins and peptides of Plasmodium falciparu...

    ID: 1341347

    Description: epitope description:YSRQYSNRAAENFKAIRE antigen name:Rhoptry-associated protein 2, RAP2 host organism:Homo sapiens

    Publication: 9715934;

  11. Cross-reactive antigenic determinants present on different Plasmodium falciparum blood-stage antigens.

    ID: 1341349

    Description: epitope description:EENVEENVEENVEENV antigen name:DNAJ protein, putative host organism:Homo sapiens antibody name:33G2

    Publication: 2467248;

  12. Cross-reactive antigenic determinants present on different Plasmodium falciparum blood-stage antigens.

    ID: 1341355

    Description: epitope description:EENVEHDA antigen name:DNAJ protein, putative host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-RESA octapep...

    Publication: 2467248;

  13. A study of antibody and T cell recognition of rhoptry-associated protein-1 (RAP-1) and RAP-2 recombinant proteins and peptides of Plasmodium falciparu...

    ID: 1341360

    Description: epitope description:KKFKAEIRDFFKEMRIQYAK antigen name:Rhoptry-associated protein 1, RAP1 host organism:Homo sapiens

    Publication: 9715934;

  14. Immunogenic properties of multiple antigen peptide systems containing defined T and B epitopes.

    ID: 1341362

    Description: epitope description:PPPPNPNDPPPPNPND antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus A/J

    Publication: 1382101;

  15. New B cell epitopes in the Plasmodium falciparum malaria circumsporozoite protein.

    ID: 1341389

    Description: epitope description:PNDPNRNVD antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c antibody name:VI6, VI7

    Publication: 1693336;

  16. New B cell epitopes in the Plasmodium falciparum malaria circumsporozoite protein.

    ID: 1341390

    Description: epitope description:PNDPNRNVD antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c antibody name:VI6, VI7

    Publication: 1693336;

  17. Immunogenic properties of multiple antigen peptide systems containing defined T and B epitopes.

    ID: 1341394

    Description: epitope description:PPPPNPNDPPPPNPND antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus A/J

    Publication: 1382101;

  18. New B cell epitopes in the Plasmodium falciparum malaria circumsporozoite protein.

    ID: 1341410

    Description: epitope description:DPNRNVDEN antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:anti-CSVI

    Publication: 1693336;

  19. New B cell epitopes in the Plasmodium falciparum malaria circumsporozoite protein.

    ID: 1341415

    Description: epitope description:ENANANNAV antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:anti-CSVI

    Publication: 1693336;

  20. New B cell epitopes in the Plasmodium falciparum malaria circumsporozoite protein.

    ID: 1341417

    Description: epitope description:VDENANANN antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:anti-CSVI

    Publication: 1693336;

  21. New B cell epitopes in the Plasmodium falciparum malaria circumsporozoite protein.

    ID: 1341425

    Description: epitope description:AVKNNNNEE antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:anti-CSVI

    Publication: 1693336;

  22. New B cell epitopes in the Plasmodium falciparum malaria circumsporozoite protein.

    ID: 1341426

    Description: epitope description:VKNNNNEEP antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:anti-CSVI

    Publication: 1693336;

  23. New B cell epitopes in the Plasmodium falciparum malaria circumsporozoite protein.

    ID: 1341429

    Description: epitope description:NNNEEPSDK antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:anti-CSVI

    Publication: 1693336;

  24. New B cell epitopes in the Plasmodium falciparum malaria circumsporozoite protein.

    ID: 1341432

    Description: epitope description:EEPSDKHIE antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:anti-CSVI

    Publication: 1693336;

  25. New B cell epitopes in the Plasmodium falciparum malaria circumsporozoite protein.

    ID: 1341433

    Description: epitope description:PSDKHIEQ antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:anti-CSVI

    Publication: 1693336;

  26. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1341441

    Description: epitope description:LKNKIFPKKKEDNQAVDT antigen name:101 kDa malaria antigen host organism:Oryctolagus cuniculus

    Publication: 9596765;

  27. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1341443

    Description: epitope description:ENDVLNQETEEEMEK antigen name:101 kDa malaria antigen host organism:Oryctolagus cuniculus

    Publication: 9596765;

  28. Identification of a Plasmodium berghei antigen sharing common features with P. falciparum and P. chabaudi parasitophorous-vacuole membrane antigens.

    ID: 1341451

    Description: epitope description:DNNLVSGP antigen name:Circumsporozoite-related antigen host organism:Oryctolagus cuniculus

    Publication: 8825207;

  29. Effects of the configuration of a multi-epitope chimeric malaria DNA vaccine on its antigenicity to mice.

    ID: 1341452

    Description: epitope description:NKNDNKNDNKND antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 11601272;

  30. Association between immune recognition of the malaria vaccine candidate antigen Pf155/RESA and resistance to clinical disease: a prospective study in ...

    ID: 1341454

    Description: epitope description:EENVEENVEENVEENVEENVEENV antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 1755042;

  31. Association between immune recognition of the malaria vaccine candidate antigen Pf155/RESA and resistance to clinical disease: a prospective study in ...

    ID: 1341459

    Description: epitope description:DDEHVEEPTVADDEHVEEPTVA antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 1755042;

  32. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341465

    Description: epitope description:MTDVNRYRYSNNYEQEPHIS host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  33. Immunogenicity of chimeric multiple antigen peptides based on Plasmodium falciparum antigens: impact of epitope orientation.

    ID: 1341483

    Description: epitope description:DPNANPNVDPNANPNV antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB.K

    Publication: 9607007;

  34. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341531

    Description: epitope description:MTDVIRYRYSNNYESNDHIS host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  35. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341537

    Description: epitope description:MTDVIRFRYSNNYEASDH host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  36. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341540

    Description: epitope description:IRYRYSNNYEANDHIS host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  37. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341551

    Description: epitope description:MTDVIRYRYSNNYESNPHIS host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  38. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341552

    Description: epitope description:MTDVIRYRYSNNYESNPHIS host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  39. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341559

    Description: epitope description:MTDVNRYRYSNNYEQGPHIS host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  40. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341560

    Description: epitope description:MTDVNRYRYSNNYEQGPHIS host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  41. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341566

    Description: epitope description:MTDVMMYRYSNNYEQGPHIS host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  42. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341568

    Description: epitope description:MTDVMFYRYSNNYEGQPHIS host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  43. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341570

    Description: epitope description:MTDVMMYRYSNNYEGQPHIS host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  44. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341575

    Description: epitope description:MTDVIRYRYSNNYEGNDHIS host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  45. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341580

    Description: epitope description:MTDVIRWRWGNNYEGNDHIS host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  46. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341581

    Description: epitope description:MTDVIRWRYSNNYEASDHIS host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  47. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341583

    Description: epitope description:TDVNRWRYVNNYESNH host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  48. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341584

    Description: epitope description:TDVNRWRYVNNYESNH host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  49. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341587

    Description: epitope description:MTDVIRYRYSNIYESSDK host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  50. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341589

    Description: epitope description:MTDSIRFRYSNNYMASDH host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  51. Modifying RESA protein peptide 6671 to fit into HLA-DRbeta1* pockets induces protection against malaria.

    ID: 1341592

    Description: epitope description:MTDSIRFRYSNNYMSIDH host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 14985134;

  52. Reproducing the immune response against the Plasmodium vivax merozoite surface protein 1 with mimotopes selected from a phage-displayed peptide librar...

    ID: 1341604

    Description: epitope description:YSTEVR host organism:Mus musculus antibody name:D14-3

    Publication: 8960114;

  53. Reproducing the immune response against the Plasmodium vivax merozoite surface protein 1 with mimotopes selected from a phage-displayed peptide librar...

    ID: 1341606

    Description: epitope description:GRVCLR host organism:Mus musculus antibody name:D14-3

    Publication: 8960114;

  54. Predominance of H-2d- and H-2k-restricted T-cell epitopes in the highly repetitive Plasmodium falciparum antigen Pf332.

    ID: 1341646

    Description: epitope description:ILVEGSVTEEVVGEEK antigen name:Antigen 332, DBL-like protein host organism:Mus musculus C57BL/10 X DBA/2

    Publication: 9293771;

  55. Antibodies to malaria peptide mimics inhibit Plasmodium falciparum invasion of erythrocytes.

    ID: 1341649

    Description: epitope description:FGGVSDEDVPSFHFKPPSSR host organism:Rattus norvegicus LOU/M antibody name:4G2dc1

    Publication: 14742560;

  56. Predominance of H-2d- and H-2k-restricted T-cell epitopes in the highly repetitive Plasmodium falciparum antigen Pf332.

    ID: 1341654

    Description: epitope description:LVSEEIVTEEGSVAQE antigen name:Antigen 332, DBL-like protein host organism:Mus musculus C57BL/10 X DBA/2

    Publication: 9293771;

  57. Antibodies to malaria peptide mimics inhibit Plasmodium falciparum invasion of erythrocytes.

    ID: 1341658

    Description: epitope description:LASLRKAFADTVPVRPPSNY host organism:Rattus norvegicus LOU/M antibody name:4G2dc1

    Publication: 14742560;

  58. Predominance of H-2d- and H-2k-restricted T-cell epitopes in the highly repetitive Plasmodium falciparum antigen Pf332.

    ID: 1341667

    Description: epitope description:SVTEEVVEEEGPVDEE antigen name:Antigen 332, DBL-like protein host organism:Mus musculus C57BL/10 X DBA/2

    Publication: 9293771;

  59. Predominance of H-2d- and H-2k-restricted T-cell epitopes in the highly repetitive Plasmodium falciparum antigen Pf332.

    ID: 1341669

    Description: epitope description:EEGPVDEEIVQEEGTV antigen name:Antigen 332, DBL-like protein host organism:Mus musculus C57BL/10 X DBA/2

    Publication: 9293771;

  60. Antibodies to malaria peptide mimics inhibit Plasmodium falciparum invasion of erythrocytes.

    ID: 1341677

    Description: epitope description:FCSLTSLATSCGAAVFIPFR host organism:Rattus norvegicus LOU/M antibody name:4G2dc1

    Publication: 14742560;

  61. Immunogenicity of chimeric multiple antigen peptides based on Plasmodium falciparum antigens: impact of epitope orientation.

    ID: 1341708

    Description: epitope description:VTEEIVTEEIVTEEI host organism:Mus musculus BALB.K

    Publication: 9607007;

  62. Immunogenicity of chimeric multiple antigen peptides based on Plasmodium falciparum antigens: impact of epitope orientation.

    ID: 1341713

    Description: epitope description:VTEEIVTEEIVTEEI host organism:Mus musculus BALB.K

    Publication: 9607007;

  63. Antibodies to malaria peptide mimics inhibit Plasmodium falciparum invasion of erythrocytes.

    ID: 1341719

    Description: epitope description:LASLRKAFADTVPVRPPSNY host organism:Homo sapiens

    Publication: 14742560;

  64. Antibodies to malaria peptide mimics inhibit Plasmodium falciparum invasion of erythrocytes.

    ID: 1341723

    Description: epitope description:IPSTAFTDIAWVRLPNHY host organism:Homo sapiens

    Publication: 14742560;

  65. Antibodies to malaria peptide mimics inhibit Plasmodium falciparum invasion of erythrocytes.

    ID: 1341729

    Description: epitope description:IPSTAFTDIAWVRLPNHY host organism:Rattus norvegicus LOU/M antibody name:4G2dc1

    Publication: 14742560;

  66. Humoral immune responses in Gambians to Pfs16, an immunodominant, Plasmodium falciparum integral membrane protein.

    ID: 1341792

    Description: epitope description:SDANDKAKKPAGKGS antigen name:Sexual stage-specific protein host organism:Homo sapiens

    Publication: 9226690;

  67. Humoral immune responses in Gambians to Pfs16, an immunodominant, Plasmodium falciparum integral membrane protein.

    ID: 1341801

    Description: epitope description:KDNTDEGDEGDDS antigen name:Sexual stage-specific protein host organism:Homo sapiens

    Publication: 9226690;

  68. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1341834

    Description: epitope description:ANGAGNQPGANGAGNQPG antigen name:Circumsporozoite protein, putative host organism:Homo sapiens

    Publication: 9164601;

  69. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1341835

    Description: epitope description:ANGAGNQPGANGAGNQPG antigen name:Circumsporozoite protein, putative host organism:Homo sapiens Caucasian

    Publication: 9164601;

  70. A novel Plasmodium falciparum sporozoite and liver stage antigen (SALSA) defines major B, T helper, and CTL epitopes.

    ID: 1341848

    Description: epitope description:SAEKKDEKEASEQGEESHKKENSQESA antigen name:Merozoite surface protein 4 host organism:Homo sapiens

    Publication: 8609407;

  71. Characterization of regulatory T cell responses to defined immunodominant T cell epitopes of the Plasmodium falciparum antigen Pf155/RESA.

    ID: 1341853

    Description: epitope description:EENVEHDAEENVEENV antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 1704342;

  72. Characterization of regulatory T cell responses to defined immunodominant T cell epitopes of the Plasmodium falciparum antigen Pf155/RESA.

    ID: 1341855

    Description: epitope description:EENVEENVEENVEENVEENVEENV antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 1704342;

  73. Evidence for diversity of Plasmodium falciparum sporozoite surface antigens derived from analysis of antibodies elicited in humans.

    ID: 1341863

    Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus antibody name:NFS1, NFS2

    Publication: 1696936;

  74. Predominance of H-2d- and H-2k-restricted T-cell epitopes in the highly repetitive Plasmodium falciparum antigen Pf332.

    ID: 1341967

    Description: epitope description:EEVVGEEKLVSEEIVT antigen name:Antigen 332, DBL-like protein host organism:Mus musculus C57BL/10 X DBA/2

    Publication: 9293771;

  75. Predominance of H-2d- and H-2k-restricted T-cell epitopes in the highly repetitive Plasmodium falciparum antigen Pf332.

    ID: 1341970

    Description: epitope description:EEGPVDEEIVQEEGTV antigen name:Antigen 332, DBL-like protein host organism:Mus musculus B10.BR

    Publication: 9293771;

  76. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1341973

    Description: epitope description:ANGAGNQPGANGAGGQAA antigen name:Circumsporozoite protein, putative host organism:Homo sapiens Caucasian

    Publication: 9164601;

  77. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1341986

    Description: epitope description:GANAPNEKSVKEYLDKVRAT antigen name:Circumsporozoite protein, putative host organism:Homo sapiens

    Publication: 9164601;

  78. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1341992

    Description: epitope description:VGTEWTPCSVTCGVGVRVRR antigen name:Circumsporozoite protein, putative host organism:Homo sapiens Caucasian

    Publication: 9164601;

  79. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1341996

    Description: epitope description:RVNAANKKPEDLTLNDLETD antigen name:Circumsporozoite protein, putative host organism:Homo sapiens Caucasian

    Publication: 9164601;

  80. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1341997

    Description: epitope description:RVNAANKKPEDLTLNDLETD antigen name:Circumsporozoite protein, putative host organism:Homo sapiens

    Publication: 9164601;

  81. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1342024

    Description: epitope description:DRADGQPAGDRADGQPAGDR antigen name:Circumsporozoite protein, putative host organism:Mus musculus B10.S(7R)

    Publication: 9164601;

  82. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1342035

    Description: epitope description:DRAAGQPAGDRAAGQPAGDRC antigen name:Circumsporozoite protein, putative host organism:Mus musculus C57BL/10 X DBA/2

    Publication: 9164601;

  83. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1342040

    Description: epitope description:DRAAGQPAGNGAGGQAAGGN antigen name:Circumsporozoite protein, putative host organism:Mus musculus B10.S(7R)

    Publication: 9164601;

  84. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1342041

    Description: epitope description:TCGVGVRVRRRVNAANKKPE antigen name:Circumsporozoite protein, putative host organism:Mus musculus C57BL/10

    Publication: 9164601;

  85. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1342044

    Description: epitope description:TCGVGVRVRRRVNAANKKPE antigen name:Circumsporozoite protein, putative host organism:Mus musculus B10.S(7R)

    Publication: 9164601;

  86. Predominance of H-2d- and H-2k-restricted T-cell epitopes in the highly repetitive Plasmodium falciparum antigen Pf332.

    ID: 1342053

    Description: epitope description:LVSEEIVTEEGSVAQE antigen name:Antigen 332, DBL-like protein host organism:Mus musculus C57BL/10.Q

    Publication: 9293771;

  87. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1342056

    Description: epitope description:VGTEWTPCSVTCGVGVRVRR antigen name:Circumsporozoite protein, putative host organism:Mus musculus B10.BR

    Publication: 9164601;

  88. Predominance of H-2d- and H-2k-restricted T-cell epitopes in the highly repetitive Plasmodium falciparum antigen Pf332.

    ID: 1342061

    Description: epitope description:IVQEEGTVTEEIIQGE antigen name:Antigen 332, DBL-like protein host organism:Mus musculus C57BL/6

    Publication: 9293771;

  89. Fine epitope specificity of antibodies to region II of the Plasmodium vivax circumsporozoite protein correlates with ability to bind recombinant prote...

    ID: 1342063

    Description: epitope description:VGTEWTPCSVTCGVGVRVRR antigen name:Circumsporozoite protein, putative host organism:Mus musculus B10.BR

    Publication: 9164601;

  90. Induction of humoral immune response against Plasmodium falciparum sporozoites by immunization with a synthetic peptide mimotope whose sequence was de...

    ID: 1342099

    Description: epitope description:QNDNPQ host organism:Mus musculus antibody name:MAb 2A10

    Publication: 7532629;

  91. Active and passive immunization against Plasmodium yoelii sporozoites.

    ID: 1342188

    Description: epitope description:QGPGAPQGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus antibody name:NYS1

    Publication: 1709834;

  92. Definition of T cell epitopes within the 19 kDa carboxylterminal fragment of Plasmodium yoelii merozoite surface protein 1 (MSP1(19)) and their role i...

    ID: 1342192

    Description: epitope description:DDNGTEEWRCLLGYKKGEGN antigen name:Merozoite surface protein 1 host organism:Mus musculus BALB/c

    Publication: 9651928;

  93. Definition of T cell epitopes within the 19 kDa carboxylterminal fragment of Plasmodium yoelii merozoite surface protein 1 (MSP1(19)) and their role i...

    ID: 1342203

    Description: epitope description:EPTPNAYYEGVFCSSSS antigen name:Merozoite surface protein 1 host organism:Mus musculus

    Publication: 9651928;

  94. Development of two monoclonal antibodies against Plasmodium falciparum sporozoite surface protein 2 and mapping of B-cell epitopes.

    ID: 1342272

    Description: epitope description:HPSDGKC antigen name:Thrombospondin-related anonymous protein, TRAP host organism:Mus musculus antibody name:PfSSP2.2

    Publication: 9234808;

  95. Induction of humoral immune response against Plasmodium falciparum sporozoites by immunization with a synthetic peptide mimotope whose sequence was de...

    ID: 1342336

    Description: epitope description:TNRNPQ host organism:Mus musculus BALB/c

    Publication: 7532629;

  96. Development of two monoclonal antibodies against Plasmodium falciparum sporozoite surface protein 2 and mapping of B-cell epitopes.

    ID: 1342373

    Description: epitope description:DRYIPYSP antigen name:Thrombospondin-related anonymous protein, TRAP host organism:Homo sapiens

    Publication: 9234808;

  97. Effect of context and adjuvant on the immunogenicity of recombinant proteins and peptide conjugates derived from the polymorphic malarial surface anti...

    ID: 1342388

    Description: epitope description:NTSDSQKE antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus Quackenbush

    Publication: 8821653;

  98. Heat shock response of Babesia divergens and identification of the hsp70 as an immunodominant early antigen during ox, gerbil and human babesiosis.

    ID: 1342411

    Description: epitope description:MPGGMPGGMPGGMPGG antigen name:Heat shock 70 kDa protein host organism:Oryctolagus cuniculus antibody name:anti-R (repeat)

    Publication: 1756315;

  99. Epitopes of the Plasmodium falciparum clustered-asparagine-rich protein (CARP) recognized by human T-cells and antibodies.

    ID: 1342419

    Description: epitope description:TFNTHEEALNVLKNIKNLIDTS antigen name:Clustered-asparagine-rich protein host organism:Homo sapiens

    Publication: 1725821;

  100. Epitopes of the Plasmodium falciparum clustered-asparagine-rich protein (CARP) recognized by human T-cells and antibodies.

    ID: 1342420

    Description: epitope description:ALNVLKNIKNLIDT antigen name:Clustered-asparagine-rich protein host organism:Homo sapiens

    Publication: 1725821;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston