Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. GP5 ectodomain epitope of porcine reproductive and respiratory syndrome virus, strain Lelystad virus.

    ID: 1501345

    Description: epitope description:QYIYNLTIC antigen name:Glycoprotein 5 host organism:Sus scrofa

    Publication: 15084406;

  2. GP5 ectodomain epitope of porcine reproductive and respiratory syndrome virus, strain Lelystad virus.

    ID: 1501369

    Description: epitope description:SSTKNLIY antigen name:major structural glycoprotein GP5 host organism:Mus musculus antibody name:159-18

    Publication: 15084406;

  3. Protection against syphilis correlates with specificity of antibodies to the variable regions of Treponema pallidum repeat protein K.

    ID: 1501385

    Description: epitope description:YANLYGGTNKQAAAAVPAT antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14500480;

  4. Protection against syphilis correlates with specificity of antibodies to the variable regions of Treponema pallidum repeat protein K.

    ID: 1501400

    Description: epitope description:KKENAANVNGTVGADALLTLGYR antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14500480;

  5. Protection against syphilis correlates with specificity of antibodies to the variable regions of Treponema pallidum repeat protein K.

    ID: 1501401

    Description: epitope description:KKENAANVNGTVGADALLTLGYR antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14500480;

  6. Protection against syphilis correlates with specificity of antibodies to the variable regions of Treponema pallidum repeat protein K.

    ID: 1501416

    Description: epitope description:ELAWGIASEDGSAGNLKHGFKTT antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14500480;

  7. Functional epitopes on porcine endogenous retrovirus envelope protein interacting with neutralizing antibody combining sites.

    ID: 1501431

    Description: epitope description:KEGGLSVALKEECCFYVDHSG antigen name:Other Porcine type-C oncovirus protein host organism:Mus musculus antibody name:7C4

    Publication: 17222436;

  8. Immunogenicity of peptides simulating a neutralization epitope of transmissible gastroenteritis virus.

    ID: 1501436

    Description: epitope description:SFFSYGEI antigen name:Spike glycoprotein host organism:Mus musculus antibody name:MAb 57.57

    Publication: 1708930;

  9. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501448

    Description: epitope description:VIDLMQTHQHGLVGALLRAA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 7693508;

  10. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501449

    Description: epitope description:PNGAPEAAL antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 7693508;

  11. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501467

    Description: epitope description:KYSAGGMGRRGDLEPLAARVAAQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7693508;

  12. Mutant derivatives of the main respiratory allergen of cow are less allergenic than the intact molecule.

    ID: 1509439

    Description: epitope description:N169 antigen name:Bos d 2 host organism:Homo sapiens

    Publication: 10383601;

  13. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509508

    Description: epitope description:STLTSLFRPGASQNV host organism:Homo sapiens

    Publication: 8986952;

  14. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509512

    Description: epitope description:STFTSLLAPGAKQNV host organism:Homo sapiens

    Publication: 8986952;

  15. Characterization of monoclonal antibodies against the Escherichia coli hemolysin.

    ID: 1509516

    Description: epitope description:KIDELIKKQKSGGNVSSSELAKASIELINQLVDT antigen name:UniProt:F4MD93 host organism:Mus musculus BALB/c antibody name:E2

    Publication: 1689701;

  16. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509521

    Description: epitope description:RGFTSLFSAGSAQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  17. Identification of immunogenic epitopes of the 170-kDa subunit adhesin of Entamoeba histolytica in patients with invasive amebiasis.

    ID: 1509526

    Description: epitope description:CRVWNQTDRTQ antigen name:Galactose-inhibitable lectin 170 kDa subunit host organism:Homo sapiens

    Publication: 7581341;

  18. Identification of immunogenic epitopes of the 170-kDa subunit adhesin of Entamoeba histolytica in patients with invasive amebiasis.

    ID: 1509530

    Description: epitope description:EFMKEADKEAY antigen name:Galactose-inhibitable lectin 170 kDa subunit host organism:Homo sapiens

    Publication: 7581341;

  19. Identification of linear antigenic sites on the Porphyromonas gingivalis 43-kDa fimbrillin subunit.

    ID: 1509605

    Description: epitope description:VVMANTGAMELVGKTLAEVK antigen name:Major fimbrial subunit protein type-1 host organism:Rattus norvegicus Wistar

    Publication: 7567063;

  20. Identification of linear antigenic sites on the Porphyromonas gingivalis 43-kDa fimbrillin subunit.

    ID: 1509611

    Description: epitope description:VPEKIYGLIAKKQSNLFGA antigen name:Major fimbrial subunit protein type-1 host organism:Rattus norvegicus Wistar

    Publication: 7567063;

  21. The molecular basis for allergen cross-reactivity: crystal structure and IgE-epitope mapping of birch pollen profilin.

    ID: 1509622

    Description: epitope description:VWAQSSSFPQFKPQE antigen name:Bet v 2 host organism:Homo sapiens

    Publication: 9016715;

  22. Human monoclonal antibodies to viral peptides.

    ID: 1509640

    Description: epitope description:AGAGGGAGGAGAGGGAGGAG antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 9289390;

  23. Molecular variation between the alpha-toxins from the type strain (NCTC 8237) and clinical isolates of Clostridium perfringens associated with disease...

    ID: 1509692

    Description: epitope description:TAFSDAYK antigen name:Phospholipase C host organism:Mus musculus BALB/c antibody name:DY2F5D11

    Publication: 8581165;

  24. Human T- and B-cell epitopes of E1 glycoprotein of rubella virus.

    ID: 1509699

    Description: epitope description:CARIWNGTQRACTFWAVNAYS antigen name:Structural polyprotein host organism:Homo sapiens

    Publication: 8320313;

  25. Human T- and B-cell epitopes of E1 glycoprotein of rubella virus.

    ID: 1509701

    Description: epitope description:AFGHSDAACWGFPTDTVMSV antigen name:Structural polyprotein host organism:Homo sapiens

    Publication: 8320313;

  26. Human T- and B-cell epitopes of E1 glycoprotein of rubella virus.

    ID: 1509704

    Description: epitope description:VSCNVTTEHPFCNTPHGQLE antigen name:Structural polyprotein host organism:Homo sapiens

    Publication: 8320313;

  27. Human T- and B-cell epitopes of E1 glycoprotein of rubella virus.

    ID: 1509709

    Description: epitope description:RLVDADDPLLRTAPGPGEVW antigen name:Structural polyprotein host organism:Homo sapiens

    Publication: 8320313;

  28. Human T- and B-cell epitopes of E1 glycoprotein of rubella virus.

    ID: 1509710

    Description: epitope description:GEVWVTPVIGSQARKCGLHI antigen name:Structural polyprotein host organism:Homo sapiens

    Publication: 8320313;

  29. Epitopic mapping of linear and conformation-dependent antigenic determinants on GP5 of five U.S. bluetongue viruses.

    ID: 1509726

    Description: epitope description:K33, A34, A35, E36, R37, F38, A39, E40, S41, E42, E159, K160, I161, L162, K163, E164, E165, D166, S167, K168, E206, I207, E208, R2...

    Publication: 1374982;

  30. Epitopic mapping of linear and conformation-dependent antigenic determinants on GP5 of five U.S. bluetongue viruses.

    ID: 1509727

    Description: epitope description:K33, A34, A35, E36, R37, F38, A39, E40, S41, E42, E159, K160, I161, L162, K163, E164, E165, D166, S167, K168, E206, I207, E208, R2...

    Publication: 1374982;

  31. Epitope mapping of T4 endonuclease VII with monoclonal antibodies reveals importance of both ends of the protein for target binding.

    ID: 1509743

    Description: epitope description:EFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKKQLRK antigen name:Recombination endonuclease VII host organism:Mus musculus C57BL/6 X BALB/c a...

    Publication: 9533878;

  32. Inhibition of cell adhesion to the virus by synthetic peptides of fiber knob of human adenovirus serotypes 2 and 3 and virus neutralisation by anti-pe...

    ID: 1509849

    Description: epitope description:LKTDLELKYKQTADFS antigen name:fiber (GenPept:197944759) host organism:Oryctolagus cuniculus

    Publication: 8896246;

  33. Inhibition of cell adhesion to the virus by synthetic peptides of fiber knob of human adenovirus serotypes 2 and 3 and virus neutralisation by anti-pe...

    ID: 1509851

    Description: epitope description:SLNAGLAPETTQATLI antigen name:fiber (GenPept:197944759) host organism:Oryctolagus cuniculus

    Publication: 8896246;

  34. Use of immunoreactive synthetic HTLV-1 peptides in the search for antibody reactivity in multiple sclerosis.

    ID: 1509872

    Description: epitope description:IQAIVSSPCHNSLILPPFSLSPV antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1546533;

  35. Use of immunoreactive synthetic HTLV-1 peptides in the search for antibody reactivity in multiple sclerosis.

    ID: 1509873

    Description: epitope description:QGGLCKALQEQCRFPNITNSHVP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1546533;

  36. Inhibition of cell adhesion to the virus by synthetic peptides of fiber knob of human adenovirus serotypes 2 and 3 and virus neutralisation by anti-pe...

    ID: 1509879

    Description: epitope description:GTSESTETSEVSTYSMS antigen name:Fiber protein host organism:Oryctolagus cuniculus

    Publication: 8896246;

  37. Inhibition of cell adhesion to the virus by synthetic peptides of fiber knob of human adenovirus serotypes 2 and 3 and virus neutralisation by anti-pe...

    ID: 1509881

    Description: epitope description:GKYTTETFATNSYTFSYIAQE antigen name:Fiber protein host organism:Oryctolagus cuniculus

    Publication: 8896246;

  38. Inhibition of cell adhesion to the virus by synthetic peptides of fiber knob of human adenovirus serotypes 2 and 3 and virus neutralisation by anti-pe...

    ID: 1509883

    Description: epitope description:LEVTVMLNKRLPDSRTS antigen name:fiber (GenPept:197944759) host organism:Oryctolagus cuniculus

    Publication: 8896246;

  39. Epitope mapping of T4 endonuclease VII with monoclonal antibodies reveals importance of both ends of the protein for target binding.

    ID: 1509887

    Description: epitope description:EFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKKQLRK antigen name:Recombination endonuclease VII host organism:Mus musculus C57BL/6 X BALB/c a...

    Publication: 9533878;

  40. Characterization of minor and major antigenic regions within the hepatitis B virus nucleocapsid.

    ID: 1509890

    Description: epitope description:DIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASA antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7505307;

  41. Characterization of minor and major antigenic regions within the hepatitis B virus nucleocapsid.

    ID: 1509901

    Description: epitope description:LCWGELMTLATWVGVNLEDPASRDL antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7505307;

  42. Characterization of minor and major antigenic regions within the hepatitis B virus nucleocapsid.

    ID: 1509903

    Description: epitope description:FHISCLTFGRETVIEYLVSFG antigen name:External core antigen host organism:Homo sapiens

    Publication: 7505307;

  43. Characterization of minor and major antigenic regions within the hepatitis B virus nucleocapsid.

    ID: 1509907

    Description: epitope description:VNLEDPASRDL antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7505307;

  44. Characterization of minor and major antigenic regions within the hepatitis B virus nucleocapsid.

    ID: 1509909

    Description: epitope description:VSYVNTNMGLKFRQL antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7505307;

  45. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509912

    Description: epitope description:GDVTSYAQIITNQIGMKAIKDGSASQRNV antigen name:Outer membrane protein P1 host organism:Mus musculus A/J

    Publication: 7558276;

  46. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509917

    Description: epitope description:IDFADRTATSLEANVIKEGKKGNLTFTLPDYLELSG antigen name:Outer membrane protein P1 host organism:Mus musculus A/J

    Publication: 7558276;

  47. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509932

    Description: epitope description:KLHASFEDGKKAFDKELQYSNNSRV antigen name:Outer membrane protein P1 host organism:Cavia porcellus

    Publication: 7558276;

  48. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509934

    Description: epitope description:LSVDLGYAYLKGKKVHFKEVKTIGDKRTL antigen name:Outer membrane protein P1 host organism:Cavia porcellus

    Publication: 7558276;

  49. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509943

    Description: epitope description:IDFADRTATSLEANVIKEGKKGNLTFTLPDYLELSG antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  50. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509959

    Description: epitope description:LYEKLTLRAGIAYDQAASRHHRSAAIPDTDRT antigen name:Outer membrane protein P1 host organism:Homo sapiens

    Publication: 7558276;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston