Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1339339

    Description: epitope description:NIISCNKNDKNQ antigen name:101 kDa malaria antigen host organism:Oryctolagus cuniculus

    Publication: 9596765;

  2. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1339341

    Description: epitope description:YKAYVSYKKRKAQEK antigen name:101 kDa malaria antigen host organism:Oryctolagus cuniculus

    Publication: 9596765;

  3. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1339346

    Description: epitope description:KEEKEEKEEKEEKEKEKE antigen name:Uncharacterized protein MAL13P1.304 host organism:Oryctolagus cuniculus

    Publication: 9596765;

  4. Protection against malaria by immunization with plasmid DNA encoding circumsporozoite protein.

    ID: 1339347

    Description: epitope description:QGPGAPQGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus BALB/cByJ

    Publication: 7937907;

  5. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1339368

    Description: epitope description:VPPTQSKKKNKNET antigen name:101 kDa malaria antigen host organism:Oryctolagus cuniculus

    Publication: 9596765;

  6. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1339373

    Description: epitope description:KEEKEEKEEKEEKEKEKE antigen name:Uncharacterized protein MAL13P1.304 host organism:Oryctolagus cuniculus

    Publication: 9596765;

  7. Multiple T helper cell epitopes of the circumsporozoite protein of Plasmodium berghei.

    ID: 1339374

    Description: epitope description:DPPPPNPNDPPPPNPND antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus

    Publication: 2464495;

  8. Immunogenicity of a non-repetitive sequence of Plasmodium falciparum circumsporozoite protein in man and mice.

    ID: 1339453

    Description: epitope description:KPKHKKLKQPGDGNP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus CBA/Ca

    Publication: 2450833;

  9. Recognition of different domains of the Plasmodium falciparum CS protein by the sera of naturally infected individuals compared with those of sporozoi...

    ID: 1339460

    Description: epitope description:SVTCGNGIQVRIKPGSANKPKDELDYENDIEKKICKMEKCSSVFNVV antigen name:Circumsporozoite (CS) protein host organism:Saimiri sciureus

    Publication: 1401909;

  10. Recognition of different domains of the Plasmodium falciparum CS protein by the sera of naturally infected individuals compared with those of sporozoi...

    ID: 1339468

    Description: epitope description:DPNANPNVDPNANPNV antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens

    Publication: 1401909;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston