Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "
  1. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467041

    Description: epitope description:STVSSAPPTRVRR antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;
  2. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467045

    Description: epitope description:SAPPTRVRR antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;
  3. Intranasal tolerance induction with polypeptides derived from 3 noncross-reactive major aeroallergens prevents allergic polysensitization in mice.

    ID: 1467259

    Description: epitope description:SKEMGETLLRAVESYLLAHSD antigen name:Bet v 1 host organism:Mus musculus BALB/c

    Publication: 16083792;
  4. Antibody responses to the env epitopes of human T-lymphotropic virus type I in rhesus macaques' naturally infected with simian T-lymphotropic virus ty...

    ID: 1467260

    Description: epitope description:SLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8395074;
  5. Antibody responses to the env epitopes of human T-lymphotropic virus type I in rhesus macaques' naturally infected with simian T-lymphotropic virus ty...

    ID: 1467265

    Description: epitope description:SPNVSVPSSSSTPLLY antigen name:Envelope glycoprotein gp62 host organism:Macaca mulatta

    Publication: 8395074;
  6. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467268

    Description: epitope description:YWPPPQGRRRF antigen name:gp60 SU host organism:Mus musculus antibody name:mAb 14F10

    Publication: 2466371;
  7. Humoral and cell-mediated immune responses in humans to the NSP4 enterotoxin of rotavirus.

    ID: 1467295

    Description: epitope description:DKLTTREIEQVELLKRIYDKL antigen name:Non-structural glycoprotein 4 host organism:Homo sapiens

    Publication: 10502271;
  8. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1467305

    Description: epitope description:KIPDPPQPDFPQLNSDWVPS antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;
  9. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1467370

    Description: epitope description:GARAMVTYDCEPRCPYVGAD antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;
  10. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1467374

    Description: epitope description:LNQTARAFPDCAICWEPSPP antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;

Displaying 10 of 1,510,353 results for " "