Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509961

    Description: epitope description:LFKTAQFSTGGVYIDSRINMNGDVTS antigen name:Outer membrane protein P1 host organism:Homo sapiens

    Publication: 7558276;

  2. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509962

    Description: epitope description:FKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF antigen name:Outer membrane protein P1 host organism:Homo sapiens

    Publication: 7558276;

  3. Determinants of OmpF porin antigenicity and structure.

    ID: 1510127

    Description: epitope description:AYSDDFFVGRV antigen name:Outer membrane protein F host organism:Mus musculus BALB/c antibody name:25

    Publication: 1691177;

  4. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510156

    Description: epitope description:GDVTSYAQIITNQIGMKAIKDGSASQRNV antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  5. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510159

    Description: epitope description:ALSTQQEPFRDLKKYLPSKDKSVVSLQDRA antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  6. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510163

    Description: epitope description:KLHASFEDGKKAFDKELQYSNNSRV antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  7. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510165

    Description: epitope description:LSVDLGYAYLKGKKVHFKEVKTIGDKRTL antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  8. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510167

    Description: epitope description:FKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  9. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510179

    Description: epitope description:KLHASFEDGKKAFDKELQYSNNSRV antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  10. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510181

    Description: epitope description:LSVDLGYAYLKGKKVHFKEVKTIGDKRTL antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  11. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510183

    Description: epitope description:FKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  12. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510193

    Description: epitope description:AAFQLAEVSTSGLGRAYAGEAAIADNASV antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  13. Synthetic peptides as functional mimics of a viral discontinuous antigenic site.

    ID: 1510206

    Description: epitope description:PSQNFGHMHKVVLPPPPPPPPPPCFLMFENVPY + OX(C24) host organism:Bos taurus antibody name:anti-D8

    Publication: 11851326;

  14. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510233

    Description: epitope description:VNDKFALGAGMNVNFGLKSEYDDSYDAGVFGGKTD antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  15. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510237

    Description: epitope description:IDFADRTATSLEANVIKEGKKGNLTFTLPDYLELSG antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  16. Characterization of antibody responses to a Plasmodium falciparum blood-stage antigen induced by a DNA prime/protein boost immunization protocol.

    ID: 1510336

    Description: epitope description:EKKIAKMEKASSVFNVVN host organism:Mus musculus CBA

    Publication: 10320644;

  17. Humoral immune response to conserved epitopes of Chlamydia trachomatis and human 60-kDa heat-shock protein in women with pelvic inflammatory disease.

    ID: 1510383

    Description: epitope description:SANNDAEIGNLI antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 9498452;

  18. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1510397

    Description: epitope description:LVAAGVDYEDERISFQDWPK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  19. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1510398

    Description: epitope description:VKWMLESLAIARYMAKKHHMMG antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  20. Characterization of monoclonal antibodies against Naja naja oxiana neurotoxin I.

    ID: 1510430

    Description: epitope description:CAPGQNLCY antigen name:Alpha-elapitoxin-Nno2a host organism:Mus musculus ICR antibody name:835, 847, 840, 849, 850, 823, 841, 848

    Publication: 7945236;

  21. Characterization of monoclonal antibodies against Naja naja oxiana neurotoxin I.

    ID: 1510460

    Description: epitope description:KTWCDAWCG antigen name:Alpha-elapitoxin-Nno2a host organism:Mus musculus ICR antibody name:848

    Publication: 7945236;

  22. Characterization of monoclonal antibodies against Naja naja oxiana neurotoxin I.

    ID: 1510505

    Description: epitope description:DAWCGSRGK antigen name:Alpha-elapitoxin-Nno2a host organism:Mus musculus ICR antibody name:835, 847, 840, 849, 850, 823, 841.

    Publication: 7945236;

  23. Characterization of monoclonal antibodies against Naja naja oxiana neurotoxin I.

    ID: 1510509

    Description: epitope description:KTWCDAWCG antigen name:Alpha-elapitoxin-Nno2a host organism:Mus musculus ICR antibody name:848

    Publication: 7945236;

  24. Characterization of monoclonal antibodies against Naja naja oxiana neurotoxin I.

    ID: 1510510

    Description: epitope description:KTWCDAWCG antigen name:Alpha-elapitoxin-Nno2a host organism:Mus musculus ICR antibody name:848

    Publication: 7945236;

  25. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1510515

    Description: epitope description:CESLKGSTGKLAVG antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  26. Characterization of monoclonal antibodies against Naja naja oxiana neurotoxin I.

    ID: 1510519

    Description: epitope description:KTWCDAWCG antigen name:Alpha-elapitoxin-Nno2a host organism:Mus musculus ICR antibody name:848

    Publication: 7945236;

  27. Characterization of monoclonal antibodies against Naja naja oxiana neurotoxin I.

    ID: 1510520

    Description: epitope description:CAPGQNLCY antigen name:Alpha-elapitoxin-Nno2a host organism:Mus musculus ICR antibody name:847, 840, 849, 841, 848

    Publication: 7945236;

  28. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1510525

    Description: epitope description:LADLVLIAVIDHVTDLDK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  29. A novel computer algorithm improves antibody epitope prediction using affinity-selected mimotopes: a case study using monoclonal antibodies against th...

    ID: 1510570

    Description: epitope description:ACNMLRWDKTIPCR host organism:Mus musculus BALB/c antibody name:E16

    Publication: 18760481;

  30. A novel computer algorithm improves antibody epitope prediction using affinity-selected mimotopes: a case study using monoclonal antibodies against th...

    ID: 1510581

    Description: epitope description:GCAIPQNAIRPPCS host organism:Mus musculus BALB/c antibody name:E16

    Publication: 18760481;

  31. A novel computer algorithm improves antibody epitope prediction using affinity-selected mimotopes: a case study using monoclonal antibodies against th...

    ID: 1510583

    Description: epitope description:TCCLCSGKLALACE host organism:Mus musculus BALB/c antibody name:E16

    Publication: 18760481;

  32. A novel computer algorithm improves antibody epitope prediction using affinity-selected mimotopes: a case study using monoclonal antibodies against th...

    ID: 1510584

    Description: epitope description:TCPLPDPDSQYCE host organism:Mus musculus BALB/c antibody name:E16

    Publication: 18760481;

  33. A novel computer algorithm improves antibody epitope prediction using affinity-selected mimotopes: a case study using monoclonal antibodies against th...

    ID: 1510587

    Description: epitope description:DCQVRRCSRDSHCE host organism:Mus musculus BALB/c antibody name:E16

    Publication: 18760481;

  34. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1510594

    Description: epitope description:LADLVLIAVIDHVTDLDK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  35. A novel computer algorithm improves antibody epitope prediction using affinity-selected mimotopes: a case study using monoclonal antibodies against th...

    ID: 1510599

    Description: epitope description:KCNSAVVPLGAQCR host organism:Mus musculus BALB/c antibody name:E24

    Publication: 18760481;

  36. A novel computer algorithm improves antibody epitope prediction using affinity-selected mimotopes: a case study using monoclonal antibodies against th...

    ID: 1510605

    Description: epitope description:YCRTNQSGAFARCT host organism:Mus musculus BALB/c antibody name:E121

    Publication: 18760481;

  37. A novel computer algorithm improves antibody epitope prediction using affinity-selected mimotopes: a case study using monoclonal antibodies against th...

    ID: 1510617

    Description: epitope description:ACTSQLLSVPSCCC host organism:Mus musculus BALB/c antibody name:E121

    Publication: 18760481;

  38. A novel computer algorithm improves antibody epitope prediction using affinity-selected mimotopes: a case study using monoclonal antibodies against th...

    ID: 1510623

    Description: epitope description:ACDPSTVMVPWPCS host organism:Mus musculus BALB/c antibody name:E121

    Publication: 18760481;

  39. A novel computer algorithm improves antibody epitope prediction using affinity-selected mimotopes: a case study using monoclonal antibodies against th...

    ID: 1510645

    Description: epitope description:QCNSFAIPPSLLCT host organism:Mus musculus BALB/c antibody name:E60

    Publication: 18760481;

  40. A novel computer algorithm improves antibody epitope prediction using affinity-selected mimotopes: a case study using monoclonal antibodies against th...

    ID: 1510649

    Description: epitope description:RCDLRYDAFVPWCP host organism:Mus musculus BALB/c antibody name:E60

    Publication: 18760481;

  41. A novel computer algorithm improves antibody epitope prediction using affinity-selected mimotopes: a case study using monoclonal antibodies against th...

    ID: 1510650

    Description: epitope description:DCFNSKNWEHAQCT host organism:Mus musculus BALB/c antibody name:E60

    Publication: 18760481;

  42. A novel computer algorithm improves antibody epitope prediction using affinity-selected mimotopes: a case study using monoclonal antibodies against th...

    ID: 1510652

    Description: epitope description:NCKSVRSGVIERCW host organism:Mus musculus BALB/c antibody name:E60

    Publication: 18760481;

  43. Protection against alpha-bungarotoxin poisoning by immunization with synthetic toxin peptides.

    ID: 1510663

    Description: epitope description:CKMWADAFTSSRGKVVECG host organism:Mus musculus BALB/c

    Publication: 8760280;

  44. Protection against alpha-bungarotoxin poisoning by immunization with synthetic toxin peptides.

    ID: 1510665

    Description: epitope description:AATCPSKKPYEEVTC antigen name:Alpha-bungarotoxin isoform A31 host organism:Mus musculus BALB/c

    Publication: 8760280;

  45. Protection against alpha-bungarotoxin poisoning by immunization with synthetic toxin peptides.

    ID: 1510667

    Description: epitope description:NHPPKRQPG antigen name:Alpha-bungarotoxin isoform A31 host organism:Mus musculus BALB/c

    Publication: 8760280;

  46. Epsilon-binding regions of the gamma subunit of Escherichia coli ATP synthase.

    ID: 1510670

    Description: epitope description:RKVIGHLAHGNLEYKHPYLEDR antigen name:ATP synthase gamma chain host organism:Rattus norvegicus antibody name:gamma-1

    Publication: 9131043;

  47. Reactivity of antibodies to heteroclitic peptides based on the Chlamydia trachomatis major outer-membrane protein.

    ID: 1510775

    Description: epitope description:YDAVPY host organism:Mus musculus antibody name:5F9

    Publication: 7516794;

  48. Reactivity of antibodies to heteroclitic peptides based on the Chlamydia trachomatis major outer-membrane protein.

    ID: 1510777

    Description: epitope description:LDAVPL host organism:Mus musculus antibody name:5F9

    Publication: 7516794;

  49. Reactivity of antibodies to heteroclitic peptides based on the Chlamydia trachomatis major outer-membrane protein.

    ID: 1510778

    Description: epitope description:DSAVPN host organism:Mus musculus antibody name:5F9

    Publication: 7516794;

  50. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510812

    Description: epitope description:PELGPPTNPFQAAVARGLRPPLHDPDTEAPTEAC antigen name:Structural polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1371169;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston