Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Development, expression, and murine testing of a multistage Plasmodium falciparum malaria vaccine candidate.

    ID: 1339469

    Description: epitope description:KPLDKFGNIYDYHYEH antigen name:Plasmodium falciparum gamete antigen 27/25 host organism:Mus musculus

    Publication: 10812234;

  2. Recognition of different domains of the Plasmodium falciparum CS protein by the sera of naturally infected individuals compared with those of sporozoi...

    ID: 1339470

    Description: epitope description:PSDKHIEQYLKKIQNSLS antigen name:Circumsporozoite (CS) protein host organism:Saimiri sciureus

    Publication: 1401909;

  3. Recognition of different domains of the Plasmodium falciparum CS protein by the sera of naturally infected individuals compared with those of sporozoi...

    ID: 1339472

    Description: epitope description:PSDKHIEQYLKKIQNSLS antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens

    Publication: 1401909;

  4. Recognition of different domains of the Plasmodium falciparum CS protein by the sera of naturally infected individuals compared with those of sporozoi...

    ID: 1339476

    Description: epitope description:IKPGSANKPKDELDYENDIE antigen name:Circumsporozoite (CS) protein host organism:Saimiri sciureus

    Publication: 1401909;

  5. T-cell immunity to peptide epitopes of liver-stage antigen 1 in an area of Papua New Guinea in which malaria is holoendemic.

    ID: 1339675

    Description: epitope description:LTMSNVKNVQTNFKSLLRNLGVS antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Homo sapie...

    Publication: 9393799;

  6. Induction of protective immune responses by immunization with linear multiepitope peptides based on conserved sequences from Plasmodium falciparum ant...

    ID: 1339788

    Description: epitope description:IEQYLKKIKNSISTEWSPCSVTCGKGTRSRKR host organism:Mus musculus FVB

    Publication: 9632590;

  7. High immunogenicity in chimpanzees of peptides and lipopeptides derived from four new Plasmodium falciparum pre-erythrocytic molecules.

    ID: 1339849

    Description: epitope description:NGKDDVKEEKKTNEKKDDGKTDKVQEKVLEKSPK antigen name:Merozoite surface protein 4 host organism:Pan troglodytes

    Publication: 10812228;

  8. High immunogenicity in chimpanzees of peptides and lipopeptides derived from four new Plasmodium falciparum pre-erythrocytic molecules.

    ID: 1339851

    Description: epitope description:STDNNNTKTISTDNNNTKTI antigen name:STARP antigen host organism:Pan troglodytes

    Publication: 10812228;

  9. Induction of protective immune responses by immunization with linear multiepitope peptides based on conserved sequences from Plasmodium falciparum ant...

    ID: 1339883

    Description: epitope description:KPKDELDYENDIEKKICKMEKCS antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c

    Publication: 9632590;

  10. Rationale for development of a synthetic vaccine against Plasmodium falciparum malaria.

    ID: 1339889

    Description: epitope description:NANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus antibody name:2C11, 3D6

    Publication: 2409595;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston