Rationale for development of a synthetic vaccine against Plasmodium falciparum malaria.

ID: 1339904

Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:human sera

The glutamate-rich protein (GLURP) of Plasmodium falciparum is a target for antibody-dependent monocyte-mediated inhibition of parasite growth in vitr...

ID: 1339919

Description: epitope description:PNFVDSQPNPQEPVEPSFVKIEKVPSEEN antigen name:Glutamate-rich protein host organism:Homo sapiens

Rationale for development of a synthetic vaccine against Plasmodium falciparum malaria.

ID: 1339981

Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:anti-sporozoite

Immunogenicity of a hybrid Plasmodium falciparum malaria antigen.

ID: 1340046

Description: epitope description:NANPNANPNANPNANPNA antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:anti-CSP repeat

Human monoclonal antibodies for the immunological characterization of a highly conserved protein domain of the hepatitis C virus glycoprotein E1.

ID: 1340056

Description: epitope description:HVSGHRMAW antigen name:Genome polyprotein host organism:Homo sapiens antibody name:UI/F30

Recognition of phage-expressed peptides containing Asx-Pro sequences by monoclonal antibodies produced against Plasmodium falciparum circumsporozoite ...

ID: 1340072

Description: epitope description:NPDPNPN antigen name:Circumsporozoite (CS) protein host organism:Mus musculus antibody name:Pf5A4.1 and Pf2F1.1

Human monoclonal antibodies for the immunological characterization of a highly conserved protein domain of the hepatitis C virus glycoprotein E1.

ID: 1340075

Description: epitope description:SGHRMAWDM antigen name:Genome polyprotein host organism:Homo sapiens antibody name:UI/F31

Human monoclonal antibodies for the immunological characterization of a highly conserved protein domain of the hepatitis C virus glycoprotein E1.

ID: 1340077

Description: epitope description:HRMAWDMMM antigen name:Genome polyprotein host organism:Homo sapiens antibody name:UI/F31

Human monoclonal antibodies for the immunological characterization of a highly conserved protein domain of the hepatitis C virus glycoprotein E1.

ID: 1340078

Description: epitope description:RMAWDMMMN antigen name:Genome polyprotein host organism:Homo sapiens antibody name:UI/F31

Preclinical evaluation of a synthetic Plasmodium falciparum MAP malaria vaccine in Aotus monkeys and mice.

ID: 1340149

Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Aotus nancymaae

Preclinical evaluation of a synthetic Plasmodium falciparum MAP malaria vaccine in Aotus monkeys and mice.

ID: 1340154

Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c

Antigenic analysis of the repeat domain of the circumsporozoite protein of Plasmodium vivax.

ID: 1340157

Description: epitope description:DRAAGQPAG antigen name:Circumsporozoite protein, putative host organism:Mus musculus BALB/c antibody name:2F2

Assessment of the protective value of antibodies to the Plasmodium falciparum ring-infected erythrocyte surface antigen (RESA): an epidemiologic study...

ID: 1340162

Description: epitope description:DDEHVEEPTVADDEHVEEPTVADDEHVEEPTVA antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:...

A single amino acid determines the specificity of a monoclonal antibody which inhibits Plasmodium chabaudi AS in vivo.

ID: 1340167

Description: epitope description:N1722 antigen name:Merozoite surface protein 1,, putative host organism:Mus musculus antibody name:NIMP23

A single amino acid determines the specificity of a monoclonal antibody which inhibits Plasmodium chabaudi AS in vivo.

ID: 1340169

Description: epitope description:N1722 antigen name:Merozoite surface protein 1,, putative host organism:Mus musculus antibody name:NIMP23

Assessment in mice of a synthetic peptide-based vaccine against the sporozoite stage of the human malaria parasite, P. falciparum.

ID: 1340178

Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C3H.Q antibody name:Mouse sera

Elongating modified conserved peptides eliminates their immunogenicity and protective efficacy against P. falciparum malaria.

ID: 1340188

Description: epitope description:QIPYNLKIRANELDVLKKLV antigen name:Merozoite surface protein 1 host organism:Aotus nancymaae

Elongating modified conserved peptides eliminates their immunogenicity and protective efficacy against P. falciparum malaria.

ID: 1340202

Description: epitope description:WNDLSNRKLVGKINTNSKYVHRNKKNDKLYRDEWWKVIKK antigen name:Erythrocyte binding antigen 175 host organism:Aotus nancymaae

Immunogenicity and in vitro protective efficacy of a recombinant multistage Plasmodium falciparum candidate vaccine.

ID: 1340247

Description: epitope description:NSGCFRHLDEREECKCLL antigen name:Merozoite surface protein 1 host organism:Oryctolagus cuniculus New Zealand White antibody name:an...

Evidence for epitope-specific thymus-independent response against a repeat sequence in a protein antigen.

ID: 1340253

Description: epitope description:GGMPGGMPGGMPGGMNFP antigen name:Heat shock 70 kDa protein host organism:Mus musculus C3H

The serum albumin-binding region of streptococcal protein G: a bacterial fusion partner with carrier-related properties.

ID: 1340263

Description: epitope description:EENVEENVEENVEENVEENVEENV antigen name:DNAJ protein, putative host organism:Oryctolagus cuniculus New Zealand White

Immunogenicity and in vitro protective efficacy of a recombinant multistage Plasmodium falciparum candidate vaccine.

ID: 1340272

Description: epitope description:LTPLEELY antigen name:Rhoptry-associated protein 1, RAP1 host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-...

Immunogenicity and in vitro protective efficacy of a recombinant multistage Plasmodium falciparum candidate vaccine.

ID: 1340280

Description: epitope description:GQHGHMHG antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Oryctolagus cuniculus New...

Human immune response in Plasmodium falciparum malaria. Synthetic peptides corresponding to known epitopes of the Pf155/RESA antigen induce production...

ID: 1340296

Description: epitope description:EENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Homo sapiens

Human immune response in Plasmodium falciparum malaria. Synthetic peptides corresponding to known epitopes of the Pf155/RESA antigen induce production...

ID: 1340299

Description: epitope description:LGRSGGDIIKKMQTL antigen name:DNAJ protein, putative host organism:Homo sapiens

B- and T-cell responses in congenic mice to repeat sequences of the malaria antigen Pf332: effects of the number of repeats.

ID: 1340324

Description: epitope description:SVTEEIAEEDKSVTEEIAEEDK host organism:Mus musculus C57BL/10

Elongating modified conserved peptides eliminates their immunogenicity and protective efficacy against P. falciparum malaria.

ID: 1340325

Description: epitope description:NIDRIYDKNLLMIKEHILAI antigen name:Erythrocyte binding antigen 175 host organism:Aotus nancymaae

Elongating modified conserved peptides eliminates their immunogenicity and protective efficacy against P. falciparum malaria.

ID: 1340337

Description: epitope description:FTYIENKLDILNNSKPNKRW antigen name:Erythrocyte binding antigen 175 host organism:Aotus nancymaae

B- and T-cell responses in congenic mice to repeat sequences of the malaria antigen Pf332: effects of the number of repeats.

ID: 1340410

Description: epitope description:SVTEEIAEEDKSVTEEIAEEDK host organism:Mus musculus B10.BR

Antigenic analysis of the repeat domain of the circumsporozoite protein of Plasmodium vivax.

ID: 1340414

Description: epitope description:CYPKNPRENKLKQP antigen name:Circumsporozoite protein, putative host organism:Homo sapiens antibody name:G-6, 61-I

Genetic control of the immune response to a synthetic vaccine against Plasmodium falciparum.

ID: 1340428

Description: epitope description:CGDELEAETQNVYAAPNANPYSLFQKEKMVLPNANPPANKKNAGC host organism:Homo sapiens

Multiple antigen peptide. A novel approach to increase detection sensitivity of synthetic peptides in solid-phase immunoassays.

ID: 1340438

Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus antibody name:2A10

Multiple antigen peptide. A novel approach to increase detection sensitivity of synthetic peptides in solid-phase immunoassays.

ID: 1340440

Description: epitope description:DPPPPNPNDPPPPNPN antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus antibody name:3D11

Characterisation of P. falciparum antigenic determinants isolated from a genomic expression library by differential antibody screening.

ID: 1340444

Description: epitope description:ESYKNSKDKELLIYLNNGELKKKNS antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:human immune sera

Rapid onset of malaria-induced mortality by immunizations with lipo-peptides: an experimental model to study deleterious immune responses and immunopa...

ID: 1340449

Description: epitope description:PPPPNPNDPPPPNPND antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus

Characterisation of P. falciparum antigenic determinants isolated from a genomic expression library by differential antibody screening.

ID: 1340468

Description: epitope description:YINNNNIPFQQKHNLPFPTDIDFDDHYIYVN antigen name:Circumsporozoite (CS) protein host organism:Saimiri sciureus antibody name:monkey ser...

Characterisation of P. falciparum antigenic determinants isolated from a genomic expression library by differential antibody screening.

ID: 1340469

Description: epitope description:YINNNNIPFQQKHNLPFPTDIDFDDHYIYVN antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:human immune s...

Characterisation of P. falciparum antigenic determinants isolated from a genomic expression library by differential antibody screening.

ID: 1340478

Description: epitope description:GIDKKKKKKNI antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:human immune sera

Characterisation of P. falciparum antigenic determinants isolated from a genomic expression library by differential antibody screening.

ID: 1340482

Description: epitope description:GAQILQTTLCARLLTARCGCVNLTADRMKRSFTLTC antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:human imm...

Characterisation of P. falciparum antigenic determinants isolated from a genomic expression library by differential antibody screening.

ID: 1340490

Description: epitope description:MNDIQIKTITIIYI antigen name:Circumsporozoite (CS) protein host organism:Saimiri sciureus antibody name:monkey serum

Enhanced epitopic response to a synthetic human malarial peptide by preimmunization with tetanus toxoid carrier.

ID: 1338193

Description: epitope description:QAQGDGANAGQPQAQGDGANAGQP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus Swiss antibody name:Mouse sera

Synthetic peptides as antigens for the detection of humoral immunity to Plasmodium falciparum sporozoites.

ID: 1338208

Description: epitope description:DPADNANPDADSESNGEPNADP antigen name:Circumsporozoite-related antigen host organism:Mus musculus antibody name:5.1 MAb

Synthetic peptides as antigens for the detection of humoral immunity to Plasmodium falciparum sporozoites.

ID: 1338217

Description: epitope description:DPADNANPDADSESNGEPNADP antigen name:Circumsporozoite-related antigen host organism:Homo sapiens

Detection of human antibodies against Plasmodium falciparum sporozoites using synthetic peptides.

ID: 1338231

Description: epitope description:NANPNANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus antibody name:2A10 and 3Sp2

Detection of human antibodies against Plasmodium falciparum sporozoites using synthetic peptides.

ID: 1338234

Description: epitope description:NANPNANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus antibody name:2A10 and 3Sp2

Plasmodium falciparum: further characterization of a functionally active region of the merozoite invasion ligand EBA-175.

ID: 1338245

Description: epitope description:NEREDERT antigen name:Erythrocyte binding antigen 175 host organism:Oryctolagus cuniculus antibody name:anti-Pf EBA-175 (1062-1103...

Plasmodium falciparum: further characterization of a functionally active region of the merozoite invasion ligand EBA-175.

ID: 1338259

Description: epitope description:SHMNRESDDGELYDEN antigen name:Erythrocyte binding antigen 175 host organism:Oryctolagus cuniculus antibody name:anti-Pf EBA-175 (1...

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338273

Description: epitope description:VTTSTPGSKGSVASG antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338283

Description: epitope description:SVASVASVASVASGG antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338286

Description: epitope description:SSGSVTSGGSVASVA antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338296

Description: epitope description:VSTQSAKNPPGATVP antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338304

Description: epitope description:VAKPAGAVSTQSAKN antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338308

Description: epitope description:GASAQSGTSGTSGTS antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338309

Description: epitope description:TSGTSGTSGPSGPSG antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338310

Description: epitope description:SGPSGPSGTSPSSRS antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338314

Description: epitope description:PPADASDSDAKSYAD antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338315

Description: epitope description:TGYGLFHKEKMILNE antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338316

Description: epitope description:TSGTSGTSGTSGTSG antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338317

Description: epitope description:GTSGTSAQSGTSGTS antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338320

Description: epitope description:TGYGLFQKEKMVL antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338322

Description: epitope description:GASAQSGASAQSGAS antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338325

Description: epitope description:GTSAPSGSGTSPSSR antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338328

Description: epitope description:SGPSGTSPSSRSNTL antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338331

Description: epitope description:SGAIPPADASDSDAK antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338340

Description: epitope description:GTSGPSGTGPSGTSP antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Plasmodium falciparum: further characterization of a functionally active region of the merozoite invasion ligand EBA-175.

ID: 1338352

Description: epitope description:EDERTLTK antigen name:Erythrocyte binding antigen 175 host organism:Oryctolagus cuniculus antibody name:anti-Pf EBA-175 (1062-1103...

Plasmodium falciparum: further characterization of a functionally active region of the merozoite invasion ligand EBA-175.

ID: 1338357

Description: epitope description:TKEYEDIV antigen name:Erythrocyte binding antigen 175 host organism:Oryctolagus cuniculus antibody name:anti-Pf EBA-175 (1062-1103...

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338361

Description: epitope description:SGGSVASGGSGNSRR antigen name:Merozoite surface protein 1 host organism:Mus musculus CD1

Plasmodium vivax: epitope mapping of monoclonal antibodies against the N-terminal region of the merozoite surface protein 1.

ID: 1338367

Description: epitope description:KPLDNIKDDIGKLETFITKNKETISNINKLI antigen name:Major blood-stage surface antigen Pv200 host organism:Mus musculus BALB/c antibody na...

Plasmodium falciparum: further characterization of a functionally active region of the merozoite invasion ligand EBA-175.

ID: 1338372

Description: epitope description:IVLKSHMN antigen name:Erythrocyte binding antigen 175 host organism:Oryctolagus cuniculus antibody name:anti-Pf EBA-175 (1062-1103...

Plasmodium falciparum: further characterization of a functionally active region of the merozoite invasion ligand EBA-175.

ID: 1338377

Description: epitope description:HMNRESDD antigen name:Erythrocyte binding antigen 175 host organism:Oryctolagus cuniculus antibody name:anti-Pf EBA-175 (1062-1103...

Fixed, epitope-specific, cytophilic antibody response to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface antigen MSP-1 i...

ID: 1338381

Description: epitope description:SNTLPRSNTSSGASP antigen name:Merozoite surface protein 1 host organism:Mus musculus CD1

Rabbit and human antibodies to a repeated amino acid sequence of a Plasmodium falciparum antigen, Pf 155, react with the native protein and inhibit me...

ID: 1338454

Description: epitope description:EENVEHDA antigen name:DNAJ protein, putative host organism:Homo sapiens

The effect of the length of a malarial epitope on its antigenicity and immunogenicity in an epitope presentation system using the Pseudomonas aerugino...

ID: 1338458

Description: epitope description:NPNANPNANPN antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

Synthetic malaria peptide vaccine elicits high levels of antibodies in vaccinees of defined HLA genotypes.

ID: 1338482

Description: epitope description:DPNANPNVDPNANPNVNANPNANPNANP host organism:Homo sapiens

Use of reconstituted influenza virus virosomes as an immunopotentiating delivery system for a peptide-based vaccine.

ID: 1338489

Description: epitope description:YSLFQKEKMVL antigen name:Merozoite surface protein 1 host organism:Mus musculus BALB/c antibody name:MoAb 9.22, 9.6, 9.14, 9.45

Analysis of immune responses against T- and B-cell epitopes from Plasmodium falciparum liver-stage antigen 1 in rodent malaria models and malaria-expo...

ID: 1338511

Description: epitope description:HTLETVNISDVNDFQISKY antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Homo sapiens

Analysis of immune responses against T- and B-cell epitopes from Plasmodium falciparum liver-stage antigen 1 in rodent malaria models and malaria-expo...

ID: 1338537

Description: epitope description:EENIGIYKELEDLIEKNENL antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Homo sapiens

Immune response gene regulation of immunity to Plasmodium berghei sporozoites and circumsporozoite protein vaccines. Overcoming genetic restriction wi...

ID: 1338605

Description: epitope description:DPAPPNANDPAPPNANDPAPPNAN antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus

Peptide mapping of conformational epitopes in a human malarial parasite heat shock protein.

ID: 1338610

Description: epitope description:DEIDRMVNDAEKYKAEDEENRKRIEA antigen name:Heat shock 70 kDa protein host organism:Oryctolagus cuniculus antibody name:anti-pep 2

Modulation of the humoral response to repeat and non-repeat sequences of the circumsporozoite protein of Plasmodium vivax using novel adjuvant and del...

ID: 1338660

Description: epitope description:EWTPCSVTCGVGVRVRSRVNAAN antigen name:Circumsporozoite (CS) protein host organism:Mus musculus CBA/J antibody name:Mouse sera

Rhoptry-associated protein 1-binding monoclonal antibody raised against a heterologous peptide sequence inhibits Plasmodium falciparum growth in vitro...

ID: 1338673

Description: epitope description:YGGPANKKNAG host organism:Mus musculus antibody name:SP5.2 and SP8.18

T- and B-cell responses of malaria immune individuals to synthetic peptides corresponding to non-repeat sequences in the N-terminal region of the Plas...

ID: 1338694

Description: epitope description:MQTLWDEIMDINKRK antigen name:DNAJ protein, putative host organism:Homo sapiens antibody name:immune sera

Immunogenicity of a non-repetitive sequence of Plasmodium falciparum circumsporozoite protein in man and mice.

ID: 1338760

Description: epitope description:KPKHKKLKQPGDGNP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

CD4(+) T-cell- and gamma interferon-dependent protection against murine malaria by immunization with linear synthetic peptides from a Plasmodium yoeli...

ID: 1338766

Description: epitope description:EESPLGFSPE antigen name:U43539 hepatocyte erythrocyte protein 17 kDa host organism:Mus musculus antibody name:NYLS3

Construction of synthetic immunogens: use of T- and B-cell epitopes of CS and RESA proteins of Plasmodium falciparum.

ID: 1338772

Description: epitope description:EENVEENV antigen name:DNAJ protein, putative host organism:Mus musculus C57BL/6

Rhoptry-associated protein 1-binding monoclonal antibody raised against a heterologous peptide sequence inhibits Plasmodium falciparum growth in vitro...

ID: 1338812

Description: epitope description:DNNYGKTIINNDFNF antigen name:Rhoptry-associated protein 1, RAP1 host organism:Mus musculus antibody name:SP5.2 and SP8.18

Rhoptry-associated protein 1-binding monoclonal antibody raised against a heterologous peptide sequence inhibits Plasmodium falciparum growth in vitro...

ID: 1338813

Description: epitope description:KTIINNDFNFDDYNY antigen name:Rhoptry-associated protein 1, RAP1 host organism:Mus musculus antibody name:SP5.2

Rhoptry-associated protein 1-binding monoclonal antibody raised against a heterologous peptide sequence inhibits Plasmodium falciparum growth in vitro...

ID: 1338820

Description: epitope description:SFLENKSSVDDGNIN antigen name:Rhoptry-associated protein 1, RAP1 host organism:Mus musculus antibody name:SP5.2

Rhoptry-associated protein 1-binding monoclonal antibody raised against a heterologous peptide sequence inhibits Plasmodium falciparum growth in vitro...

ID: 1338835

Description: epitope description:LYPTNVNLFNYKYSL antigen name:Rhoptry-associated protein 1, RAP1 host organism:Mus musculus antibody name:SP5.2 and SP8.18

Rhoptry-associated protein 1-binding monoclonal antibody raised against a heterologous peptide sequence inhibits Plasmodium falciparum growth in vitro...

ID: 1338837

Description: epitope description:YKYSLNNMEENINIL antigen name:Rhoptry-associated protein 1, RAP1 host organism:Mus musculus antibody name:SP5.2 and SP8.18

Rhoptry-associated protein 1-binding monoclonal antibody raised against a heterologous peptide sequence inhibits Plasmodium falciparum growth in vitro...

ID: 1338840

Description: epitope description:KNEGDLVAQKEEFEY antigen name:Rhoptry-associated protein 1, RAP1 host organism:Mus musculus antibody name:SP5.2

Rhoptry-associated protein 1-binding monoclonal antibody raised against a heterologous peptide sequence inhibits Plasmodium falciparum growth in vitro...

ID: 1338843

Description: epitope description:ESDEAPFMFSENKFL antigen name:Rhoptry-associated protein 1, RAP1 host organism:Mus musculus antibody name:SP5.2

Rhoptry-associated protein 1-binding monoclonal antibody raised against a heterologous peptide sequence inhibits Plasmodium falciparum growth in vitro...

ID: 1338845

Description: epitope description:INVNGDNNYGKTIIN antigen name:Rhoptry-associated protein 1, RAP1 host organism:Mus musculus antibody name:RAP1-14, RAP1-8 and RAP5-...

Rhoptry-associated protein 1-binding monoclonal antibody raised against a heterologous peptide sequence inhibits Plasmodium falciparum growth in vitro...

ID: 1338850

Description: epitope description:WTPINKKEFLNSYED antigen name:Rhoptry-associated protein 1, RAP1 host organism:Mus musculus antibody name:RAP1-14, RAP1-8 and RAP5-...

Rhoptry-associated protein 1-binding monoclonal antibody raised against a heterologous peptide sequence inhibits Plasmodium falciparum growth in vitro...

ID: 1338853

Description: epitope description:SFLENKSSVDDGNIN antigen name:Rhoptry-associated protein 1, RAP1 host organism:Mus musculus antibody name:RAP1-14, RAP1-7 and RAP5-...

Peptide mapping of conformational epitopes in a human malarial parasite heat shock protein.

ID: 1338859

Description: epitope description:KSSLEDQKIKEKLQP antigen name:Circumsporozoite (CS) protein host organism:Aotus trivirgatus antibody name:immune sera

Immunogenicity of a non-repetitive sequence of Plasmodium falciparum circumsporozoite protein in man and mice.

ID: 1338870

Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

Plasmodium chabaudi antigen Pch105, Plasmodium falciparum antigen Pf155, and erythrocyte band 3 share cross-reactive epitopes.

ID: 1338888

Description: epitope description:EENVEHDA antigen name:DNAJ protein, putative host organism:Mus musculus antibody name:1F1

Re-investigation of the circumsporozoite protein-based induction of sterile immunity against Plasmodium berghei infection.

ID: 1338897

Description: epitope description:DPPPPNPNDPPPPNPN antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus