Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510815

    Description: epitope description:VRAYNQPAGDVRGVWGKGERTYAEQDFRV antigen name:Structural polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1371169;

  2. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510818

    Description: epitope description:MASTTPITMEDLQKALEAQSRALRAGLAAG antigen name:Structural polyprotein host organism:Homo sapiens

    Publication: 1371169;

  3. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510820

    Description: epitope description:TPAVTPEGPAPPRTGAWQRKDWSRAPP antigen name:Structural polyprotein host organism:Homo sapiens

    Publication: 1371169;

  4. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510832

    Description: epitope description:PELGPPTNPFQAAVARGLRPPLHDPDTEAPTEAC antigen name:Structural polyprotein host organism:Mus musculus

    Publication: 1371169;

  5. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510834

    Description: epitope description:AAGASQSRRPRPPRHARAQHLPEMTPAVT antigen name:Structural polyprotein host organism:Mus musculus

    Publication: 1371169;

  6. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510837

    Description: epitope description:GTPPLDEDGRWDPALMYNPCGPEPPAHV antigen name:Structural polyprotein host organism:Mus musculus

    Publication: 1371169;

  7. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510841

    Description: epitope description:MASTTPITMEDLQKALEAQSRALRAGLAAG antigen name:Structural polyprotein host organism:Oryctolagus cuniculus

    Publication: 1371169;

  8. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510844

    Description: epitope description:SRAPPQQPQPPRMQTGRGGSAPRPELGP antigen name:Structural polyprotein host organism:Oryctolagus cuniculus

    Publication: 1371169;

  9. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549270

    Description: epitope description:DFPDSPLLPKFQ antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  10. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549278

    Description: epitope description:LPKFQELNQNNL antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  11. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549280

    Description: epitope description:KFQELNQNNLPN antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  12. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549288

    Description: epitope description:NLPNDVFREAQR antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  13. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549292

    Description: epitope description:DVFREAQRSYLV antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  14. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549294

    Description: epitope description:FREAQRSYLVFL antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  15. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549300

    Description: epitope description:SYLVFLTSQFCY antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  16. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549308

    Description: epitope description:SQFCYEEYVQRT antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  17. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549325

    Description: epitope description:AGAHAHLGGSSA antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  18. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549328

    Description: epitope description:HAHLGGSSATPV antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  19. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549331

    Description: epitope description:LGGSSATPVQQA antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  20. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549332

    Description: epitope description:GGSSATPVQQAQ antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  21. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549334

    Description: epitope description:SSATPVQQAQAA antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  22. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549353

    Description: epitope description:LASSAPSTAVAQ antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  23. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549362

    Description: epitope description:AAAVDTGSGGGG antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  24. Neutralizing antibodies derived from the B cells of 1918 influenza pandemic survivors.

    ID: 1549459

    Description: epitope description:K180 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:2B12

    Publication: 18716625;

  25. Neutralizing antibodies derived from the B cells of 1918 influenza pandemic survivors.

    ID: 1549477

    Description: epitope description:P200 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:1F1

    Publication: 18716625;

  26. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549497

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  27. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549499

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  28. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549503

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  29. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549504

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  30. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549513

    Description: epitope description:RDPSKMRDIDRHHEYNVREGND antigen name:Myosin-like protein host organism:Homo sapiens

    Publication: 15916786;

  31. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549526

    Description: epitope description:VTVVTTSGS antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  32. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549528

    Description: epitope description:RDPSKMRDIDRHHEYNVREGND antigen name:Myosin-like protein host organism:Homo sapiens

    Publication: 15916786;

  33. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549530

    Description: epitope description:NPTIAG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  34. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549535

    Description: epitope description:GAGDVK antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  35. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549536

    Description: epitope description:AGDVKA antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  36. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549539

    Description: epitope description:VKASAE antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  37. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549545

    Description: epitope description:VTVVTTSGS antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  38. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549554

    Description: epitope description:AYEQPIERTVVGHQTLRDIFVWG antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  39. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549555

    Description: epitope description:VTVVTTSGS antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  40. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549559

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  41. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549562

    Description: epitope description:AYEQPIERTVVGHQTLRDIFVWG antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  42. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549565

    Description: epitope description:RDPSKMRDIDRHHEYNVREGND antigen name:Myosin-like protein host organism:Homo sapiens

    Publication: 15916786;

  43. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549569

    Description: epitope description:GGTEESVVTASRS antigen name:Other Taenia saginata (beef tapeworm) protein host organism:Homo sapiens

    Publication: 15916786;

  44. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549576

    Description: epitope description:RFVKTPSKKKTKSR antigen name:Tsa-18 protein host organism:Homo sapiens

    Publication: 15916786;

  45. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549589

    Description: epitope description:GGTEESVVTASRS antigen name:Other Taenia saginata (beef tapeworm) protein host organism:Homo sapiens

    Publication: 15916786;

  46. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549595

    Description: epitope description:RDPSKMRDIDRHHEYNVREGND antigen name:Myosin-like protein host organism:Homo sapiens

    Publication: 15916786;

  47. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549608

    Description: epitope description:VTVVTTSGS antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  48. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549612

    Description: epitope description:AYEQPIERTVVGHQTLRDIFVWG antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  49. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549613

    Description: epitope description:VTVVTTSGS antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  50. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549616

    Description: epitope description:RFVKTPSKKKTKSR antigen name:Tsa-18 protein host organism:Homo sapiens

    Publication: 15916786;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston