Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510854

    Description: epitope description:SRAPPPPEERQESRSQTPAPKPSRAPP antigen name:Structural polyprotein host organism:Oryctolagus cuniculus

    Publication: 1371169;

  2. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510855

    Description: epitope description:SRAPPQQPQPPRMQTGRGGSAPRPELGP antigen name:Structural polyprotein host organism:Oryctolagus cuniculus

    Publication: 1371169;

  3. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510859

    Description: epitope description:PLPPHTTERIETRSARHPWRIRFGAP antigen name:Structural polyprotein host organism:Oryctolagus cuniculus

    Publication: 1371169;

  4. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510862

    Description: epitope description:GTPPLDEDGRWDPALMYNPCGPEPPAHV antigen name:Structural polyprotein host organism:Oryctolagus cuniculus

    Publication: 1371169;

  5. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510863

    Description: epitope description:PSCSPTNMIMDGTASVNIPA antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  6. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510864

    Description: epitope description:MDGTASVNIPAGTYDFAIAA antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  7. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510866

    Description: epitope description:PQANAKIWIAGQGPTKEDDY antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  8. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510868

    Description: epitope description:LMKKMGSGDGTELTISEGGG antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  9. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510869

    Description: epitope description:TELTISEGGGSDYTYTVYRD antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  10. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510874

    Description: epitope description:YTAGVSPKVCKDVTVEGSNE antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  11. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510876

    Description: epitope description:FAPVQNLTGSAVGQKVTLKW antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  12. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510885

    Description: epitope description:FGLGGIGVLTPDNYLITPAL antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  13. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510891

    Description: epitope description:TGNDASNFTNALLEETITAK antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  14. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1510926

    Description: epitope description:QMGAAPTTSDVAGLEKDPVANVARP host organism:Mus musculus A/J

    Publication: 1694217;

  15. Common epitopes in the circumsporozoite proteins of Plasmodium berghei and Plasmodium gallinaceum identified by monoclonal antibodies to the P. gallin...

    ID: 1510935

    Description: epitope description:DPDPPDANDPAPPNAN antigen name:Circumsporozoite protein host organism:Mus musculus BALB/c antibody name:N2H1D5, N2H6D5, N8B4H2, N8D...

    Publication: 7681341;

  16. Common epitopes in the circumsporozoite proteins of Plasmodium berghei and Plasmodium gallinaceum identified by monoclonal antibodies to the P. gallin...

    ID: 1510947

    Description: epitope description:DPDPPDANDPAPPNAN antigen name:Circumsporozoite protein host organism:Mus musculus BALB/c antibody name:N2H1D5, N2H6D5

    Publication: 7681341;

  17. Monoclonal antibodies detect a single amino Acid difference between the coat proteins of soilborne wheat mosaic virus isolates: implications for virus...

    ID: 1510970

    Description: epitope description:VNKGYTGY antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR 134

    Publication: 18945172;

  18. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1510975

    Description: epitope description:ILWEGFGGDPCDPCTTWCDAISMRM host organism:Mus musculus A/J

    Publication: 1694217;

  19. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1510981

    Description: epitope description:TWCDAISMRMGYYGDFVFDRVLKTD host organism:Mus musculus A/J

    Publication: 1694217;

  20. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1510985

    Description: epitope description:KHMQDAEMFTNAAYMALNIWDRFDV host organism:Mus musculus A/J

    Publication: 1694217;

  21. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1510987

    Description: epitope description:KHMQDAEMFTNAAYMALNIWDRFDV host organism:Mus musculus A/J

    Publication: 1694217;

  22. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1510990

    Description: epitope description:ALNIWDRFDVFCTLGATTGYLKGNS host organism:Mus musculus A/J

    Publication: 1694217;

  23. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1510995

    Description: epitope description:ANIVPNTALNQAVVELYTDTTFAWS host organism:Mus musculus A/J

    Publication: 1694217;

  24. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1511001

    Description: epitope description:NELADTMQIVSLQLNKMKSRKSCGI host organism:Mus musculus A/J

    Publication: 1694217;

  25. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1511008

    Description: epitope description:KMKSRKSCGIAVGTTVVDADKYAVT host organism:Mus musculus A/J

    Publication: 1694217;

  26. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1511009

    Description: epitope description:KMKSRKSCGIAVGTTVVDADKYAVT host organism:Mus musculus A/J

    Publication: 1694217;

  27. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1511015

    Description: epitope description:VVDADKYAVTIETRLIDERAAHVNA host organism:Mus musculus A/J

    Publication: 1694217;

  28. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1511039

    Description: epitope description:QMGAAPTTSDVAGLEKDPVANVARP host organism:Mus musculus A/J

    Publication: 1694217;

  29. Antigenic structure of the central conserved region of protein G of bovine respiratory syncytial virus.

    ID: 1511097

    Description: epitope description:STCEGNLACLSL antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:48, 49, 50, 53, 62, 66

    Publication: 9094683;

  30. Mapping the subgroup epitopes of rotavirus protein VP6.

    ID: 1511101

    Description: epitope description:A172, A305 antigen name:Intermediate capsid protein VP6 host organism:Mus musculus BALB/c antibody name:255/60

    Publication: 7522369;

  31. B cell responses to a peptide epitope. II: Multiple levels of selection during maturation of primary responses.

    ID: 1511120

    Description: epitope description:DPAF antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:624

    Publication: 9243289;

  32. B cell responses to a peptide epitope. II: Multiple levels of selection during maturation of primary responses.

    ID: 1511122

    Description: epitope description:DPAF antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:627

    Publication: 9243289;

  33. Conformational mimicry of a chlamydial neutralization epitope on filamentous phage.

    ID: 1511131

    Description: epitope description:SAETIFDVTTLNPTIAGSDVAGLQNDPTTN antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 7523368;

  34. Epitopes and active sites of the RecA protein.

    ID: 1511138

    Description: epitope description:TCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALE antigen name:Protein RecA host organism:Mus musculus BALB/c antibody name:ARM321

    Publication: 1692839;

  35. T and B cell epitope mapping of SM23, an integral membrane protein of Schistosoma mansoni.

    ID: 1511178

    Description: epitope description:GAGAYVEVKFSQYGDNLHKVWQAA antigen name:Tetraspanin host organism:Mus musculus C57BL/6

    Publication: 1281197;

  36. Adenovirus type 5 fiber knob binds to MHC class I alpha2 domain at the surface of human epithelial and B lymphoblastoid cells.

    ID: 1511443

    Description: epitope description:LAPISGTVQSAHLIIRFD antigen name:Fiber protein host organism:Mus musculus BALB/c antibody name:1D6.3

    Publication: 9171344;

  37. Adenovirus type 5 fiber knob binds to MHC class I alpha2 domain at the surface of human epithelial and B lymphoblastoid cells.

    ID: 1511467

    Description: epitope description:LIPFNS host organism:Mus musculus BALB/c antibody name:1D6.3

    Publication: 9171344;

  38. Adenovirus type 5 fiber knob binds to MHC class I alpha2 domain at the surface of human epithelial and B lymphoblastoid cells.

    ID: 1511473

    Description: epitope description:HFQYRM host organism:Mus musculus BALB/c antibody name:1D6.3

    Publication: 9171344;

  39. Adenovirus type 5 fiber knob binds to MHC class I alpha2 domain at the surface of human epithelial and B lymphoblastoid cells.

    ID: 1511486

    Description: epitope description:IARLIS host organism:Mus musculus BALB/c antibody name:7A2.7

    Publication: 9171344;

  40. Characterization of intertype specific epitopes on adenovirus hexons.

    ID: 1511526

    Description: epitope description:THLSYKPGKGDE antigen name:Hexon protein host organism:Mus musculus BALB/c

    Publication: 9787653;

  41. Characterization of intertype specific epitopes on adenovirus hexons.

    ID: 1511529

    Description: epitope description:NQAVDSYDPD antigen name:Hexon protein host organism:Mus musculus BALB/c

    Publication: 9787653;

  42. Novel version of Multiple Antigenic Peptide allowing incorporation on a cysteine functionalized lysine tree.

    ID: 1511535

    Description: epitope description:YGVKSSLEDQKIKEKLQPAEIET antigen name:Heat shock 70 kDa protein host organism:Mus musculus BALB/c

    Publication: 1385347;

  43. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511560

    Description: epitope description:EQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  44. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511562

    Description: epitope description:TQEENTERHTTEDVSPS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  45. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511563

    Description: epitope description:NKGKDKDVNAGTSGTHT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  46. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511569

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  47. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511570

    Description: epitope description:DGEEQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  48. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511575

    Description: epitope description:NKGKDKDVNAGTSGTHT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  49. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511577

    Description: epitope description:APQQIDISNTRATQSQFD antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  50. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511579

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston