Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511595

    Description: epitope description:GLMVWCIENGTSPNVNGV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  2. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511597

    Description: epitope description:DGEEQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  3. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511603

    Description: epitope description:GLMVWCIENGTSPNVNGV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  4. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511610

    Description: epitope description:APQQIDISNTRATQSQFD antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  5. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511615

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  6. Autoantibodies to the HLA-B27 sequence cross-react with the hypothetical peptide from the arthritis-associated Shigella plasmid.

    ID: 1511882

    Description: epitope description:AKAQTDREDLRTLLRY antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Homo sapiens antibody name:an...

    Publication: 2212008;

  7. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511902

    Description: epitope description:DNLAPMSDGAVQPDG antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  8. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511907

    Description: epitope description:QPDGGQPAVRNERAT antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  9. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511911

    Description: epitope description:GQPAVRNERATGSGN antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  10. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511617

    Description: epitope description:NKGKDKDVNAGTSGTHT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  11. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511623

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  12. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511624

    Description: epitope description:TQEENTERHTTEDVSPS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  13. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511628

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  14. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511629

    Description: epitope description:DGEEQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  15. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511634

    Description: epitope description:APQQIDISNTRATQSQFD antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  16. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511646

    Description: epitope description:DGEEQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  17. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511647

    Description: epitope description:EQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  18. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511659

    Description: epitope description:EQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  19. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511668

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  20. Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.

    ID: 1511684

    Description: epitope description:L237, G238, G239, K257, A260, K261, T264, W269, S270, G271, E272, K273, Y276, N279, G283, W284, G285, G308, G309, S310, S311, G413...

    Publication: 11960990;

  21. Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.

    ID: 1511686

    Description: epitope description:Y2, P154, Y155, W203, P204, G205, D206, K208, K243, S245, E246, F248, G249, E282, G285, P288, R291 antigen name:Pancreatic alpha-a...

    Publication: 11960990;

  22. Identification of operationally overlapping and independent cross-reactive neutralization regions on human rotavirus VP4.

    ID: 1511751

    Description: epitope description:D385, A392, S428, E433 antigen name:Outer capsid protein VP4 host organism:Mus musculus BALB/c antibody name:KU-12H

    Publication: 1701477;

  23. Identification of operationally overlapping and independent cross-reactive neutralization regions on human rotavirus VP4.

    ID: 1511753

    Description: epitope description:D385, A392, S428, E433 antigen name:Outer capsid protein VP4 host organism:Mus musculus BALB/c antibody name:KU-12H

    Publication: 1701477;

  24. Identification of operationally overlapping and independent cross-reactive neutralization regions on human rotavirus VP4.

    ID: 1511758

    Description: epitope description:A392 antigen name:Outer capsid protein VP4 host organism:Mus musculus BALB/c antibody name:KU-10C

    Publication: 1701477;

  25. Identification of operationally overlapping and independent cross-reactive neutralization regions on human rotavirus VP4.

    ID: 1511764

    Description: epitope description:S428, E433 antigen name:Outer capsid protein VP4 host organism:Mus musculus BALB/c antibody name:KU-2A, KU-7E, KU10H

    Publication: 1701477;

  26. Localization of a domain in the FimH adhesin of Escherichia coli type 1 fimbriae capable of receptor recognition and use of a domain-specific antibody...

    ID: 1511769

    Description: epitope description:AATTVNGGTVHFK antigen name:Type-1 fimbrial protein, A chain host organism:Oryctolagus cuniculus

    Publication: 9276729;

  27. Localization of a domain in the FimH adhesin of Escherichia coli type 1 fimbriae capable of receptor recognition and use of a domain-specific antibody...

    ID: 1511776

    Description: epitope description:CKTANGTAIPIGGGSANVYVNLAPV antigen name:Protein FimH host organism:Mus musculus ICR

    Publication: 9276729;

  28. Localization of a domain in the FimH adhesin of Escherichia coli type 1 fimbriae capable of receptor recognition and use of a domain-specific antibody...

    ID: 1511781

    Description: epitope description:NYARTGGQVTAG antigen name:Protein FimH host organism:Mus musculus ICR

    Publication: 9276729;

  29. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1511784

    Description: epitope description:DLKCSLPHRNESNKWTCAARRKGSRRDSLYIAGRDFWGR antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;

  30. Autoantibodies to the HLA-B27 sequence cross-react with the hypothetical peptide from the arthritis-associated Shigella plasmid.

    ID: 1511797

    Description: epitope description:AKAQTDREDLRTLLRY antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Oryctolagus cuniculus antibod...

    Publication: 2212008;

  31. Inhibition of cell adhesion to the virus by synthetic peptides of fiber knob of human adenovirus serotypes 2 and 3 and virus neutralisation by anti-pe...

    ID: 1511840

    Description: epitope description:GKYTTETFATNSYTFSYIAQE antigen name:Fiber protein host organism:Oryctolagus cuniculus

    Publication: 8896246;

  32. VEGF and the Fab fragment of a humanized neutralizing antibody: crystal structure of the complex at 2.4 A resolution and mutational analysis of the in...

    ID: 1511861

    Description: epitope description:V: F43, Y47; W: Y71, K74, Q105, I106, M107, R108, I109, K110, H112, Q113, G114, Q115, H116, I117, G118, E119, M120 antigen name:Va...

    Publication: 9753694;

  33. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511930

    Description: epitope description:AVNGNMALDDIHAQI antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  34. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511938

    Description: epitope description:AAASSPDAHVPF antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  35. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511940

    Description: epitope description:SPDAHVPFCFGK antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  36. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511942

    Description: epitope description:HVPFCFGKDLKR antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  37. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511944

    Description: epitope description:CFGKDLKRPGSS antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  38. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511947

    Description: epitope description:KRPGSSPMEVML antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  39. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511951

    Description: epitope description:MLRAVFMQQRPL antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  40. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511955

    Description: epitope description:RALGLPPFLNSLPQS antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  41. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511956

    Description: epitope description:RALGLPPFLNSLPQS antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  42. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511958

    Description: epitope description:RAVFMQQRPLRM antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  43. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511959

    Description: epitope description:VFMQQRPLRMFL antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  44. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511967

    Description: epitope description:QQMSINVDNQFNYVP antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  45. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513252

    Description: epitope description:ETDEEYYSVEKLIGQAEDVEHEYHK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  46. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513278

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  47. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513279

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  48. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1513315

    Description: epitope description:ALNIWDRFDVFCTLGATTGYLKGNSPTTSDVAGLEKDPVA host organism:Mus musculus A/J

    Publication: 1694217;

  49. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513319

    Description: epitope description:LADLVLIAVIDHVTDLDK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  50. Characterization of intertype specific epitopes on adenovirus hexons.

    ID: 1513324

    Description: epitope description:NQAVDSYDPD antigen name:Hexon protein host organism:Mus musculus BALB/c

    Publication: 9787653;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston